Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FA34

Protein Details
Accession A0A0C4FA34    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-174APAPSKPPLKRDRERDRAPDRERDQRDRDRRRHPPAPSRBasic
NLS Segment(s)
PositionSequence
138-174APSKPPLKRDRERDRAPDRERDQRDRDRRRHPPAPSR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MSTPPPPEPEHDPPPKPENEEPVPPAIDPELINKITRFKALREQGIYFNDNLVQSKAYRNPNIYTKLVEFLDLRETTTNFAPSFWDPLGFPSSAYADALRQRQQSLADEKDKQRSSAAARTTIDFQHARAPASSSAPAPSKPPLKRDRERDRAPDRERDQRDRDRRRHPPAPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.59
4 0.55
5 0.54
6 0.5
7 0.53
8 0.49
9 0.46
10 0.43
11 0.36
12 0.33
13 0.25
14 0.22
15 0.16
16 0.18
17 0.19
18 0.19
19 0.21
20 0.2
21 0.24
22 0.23
23 0.29
24 0.26
25 0.24
26 0.33
27 0.38
28 0.44
29 0.43
30 0.44
31 0.43
32 0.45
33 0.44
34 0.34
35 0.28
36 0.24
37 0.21
38 0.19
39 0.15
40 0.12
41 0.11
42 0.16
43 0.22
44 0.26
45 0.29
46 0.31
47 0.33
48 0.38
49 0.42
50 0.39
51 0.35
52 0.29
53 0.29
54 0.26
55 0.24
56 0.18
57 0.14
58 0.18
59 0.16
60 0.15
61 0.14
62 0.14
63 0.14
64 0.15
65 0.16
66 0.11
67 0.11
68 0.12
69 0.12
70 0.14
71 0.12
72 0.12
73 0.1
74 0.11
75 0.14
76 0.11
77 0.11
78 0.09
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.11
85 0.15
86 0.17
87 0.17
88 0.18
89 0.19
90 0.2
91 0.23
92 0.25
93 0.27
94 0.28
95 0.33
96 0.35
97 0.42
98 0.41
99 0.38
100 0.33
101 0.32
102 0.32
103 0.33
104 0.33
105 0.29
106 0.29
107 0.3
108 0.31
109 0.29
110 0.28
111 0.22
112 0.2
113 0.22
114 0.23
115 0.22
116 0.21
117 0.23
118 0.2
119 0.23
120 0.23
121 0.17
122 0.19
123 0.2
124 0.2
125 0.2
126 0.25
127 0.31
128 0.33
129 0.42
130 0.48
131 0.55
132 0.64
133 0.72
134 0.76
135 0.78
136 0.82
137 0.84
138 0.83
139 0.84
140 0.8
141 0.8
142 0.75
143 0.75
144 0.75
145 0.74
146 0.74
147 0.74
148 0.8
149 0.81
150 0.84
151 0.85
152 0.87
153 0.88
154 0.88