Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F9U5

Protein Details
Accession A0A0C4F9U5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-162SECNPKKFYKIPKIDRSKPKASGSKPYERKPKSSANKWKETFHydrophilic
NLS Segment(s)
PositionSequence
127-159KFYKIPKIDRSKPKASGSKPYERKPKSSANKWK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MVDTRSGKDHSANPPPPKEVEEGKAKEDKLEVVVKVPPRVLNKAQEDAIAIFKATKAAYLNAKNYDEMELLKQVISSFRVVQKFLPWKEILANHSDGWNPYTERKHIKVLEDNKKSTKESSECNPKKFYKIPKIDRSKPKASGSKPYERKPKSSANKWKETFKMARVLIKAKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.57
4 0.53
5 0.5
6 0.44
7 0.41
8 0.43
9 0.41
10 0.43
11 0.46
12 0.43
13 0.4
14 0.36
15 0.32
16 0.26
17 0.27
18 0.23
19 0.2
20 0.24
21 0.25
22 0.26
23 0.27
24 0.27
25 0.27
26 0.33
27 0.35
28 0.39
29 0.4
30 0.42
31 0.4
32 0.36
33 0.33
34 0.28
35 0.26
36 0.18
37 0.13
38 0.1
39 0.09
40 0.11
41 0.09
42 0.09
43 0.09
44 0.11
45 0.18
46 0.22
47 0.25
48 0.27
49 0.28
50 0.27
51 0.27
52 0.26
53 0.2
54 0.16
55 0.14
56 0.11
57 0.11
58 0.1
59 0.1
60 0.08
61 0.09
62 0.1
63 0.09
64 0.1
65 0.15
66 0.16
67 0.16
68 0.17
69 0.22
70 0.28
71 0.27
72 0.29
73 0.25
74 0.24
75 0.26
76 0.28
77 0.23
78 0.19
79 0.2
80 0.16
81 0.17
82 0.17
83 0.15
84 0.13
85 0.13
86 0.11
87 0.14
88 0.16
89 0.2
90 0.25
91 0.27
92 0.33
93 0.33
94 0.36
95 0.41
96 0.48
97 0.54
98 0.55
99 0.56
100 0.53
101 0.54
102 0.51
103 0.45
104 0.42
105 0.34
106 0.32
107 0.38
108 0.45
109 0.48
110 0.5
111 0.55
112 0.5
113 0.54
114 0.57
115 0.58
116 0.57
117 0.62
118 0.68
119 0.72
120 0.8
121 0.83
122 0.87
123 0.85
124 0.82
125 0.78
126 0.77
127 0.75
128 0.69
129 0.7
130 0.67
131 0.7
132 0.7
133 0.72
134 0.74
135 0.7
136 0.72
137 0.67
138 0.71
139 0.7
140 0.73
141 0.76
142 0.74
143 0.8
144 0.78
145 0.8
146 0.73
147 0.71
148 0.67
149 0.6
150 0.6
151 0.52
152 0.55
153 0.52
154 0.53
155 0.47
156 0.46
157 0.44