Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6TL83

Protein Details
Accession A0A1V6TL83    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
97-132AASKIEKASRQQRKQRKNRSKKFRGVAKVKGPKKSKBasic
NLS Segment(s)
PositionSequence
99-133SKIEKASRQQRKQRKNRSKKFRGVAKVKGPKKSKD
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTPVTLRTRKFIRNPLLARKQMVVDVLHPNRPNVSKDELREKLADLYKSNKDQVSVFGFRTQYGGGKSTGFALVYDSSEALKKFEPHYRLVRIGAASKIEKASRQQRKQRKNRSKKFRGVAKVKGPKKSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.7
4 0.74
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.3
25 0.34
26 0.42
27 0.41
28 0.41
29 0.39
30 0.36
31 0.35
32 0.35
33 0.33
34 0.25
35 0.28
36 0.3
37 0.32
38 0.33
39 0.28
40 0.25
41 0.23
42 0.25
43 0.26
44 0.23
45 0.21
46 0.22
47 0.21
48 0.2
49 0.21
50 0.18
51 0.13
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.12
72 0.15
73 0.21
74 0.23
75 0.27
76 0.33
77 0.36
78 0.37
79 0.36
80 0.35
81 0.3
82 0.3
83 0.26
84 0.24
85 0.2
86 0.19
87 0.21
88 0.2
89 0.21
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.79
97 0.87
98 0.91
99 0.92
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.92
106 0.91
107 0.9
108 0.87
109 0.86
110 0.85
111 0.85
112 0.81
113 0.81