Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6S1H2

Protein Details
Accession A0A1V6S1H2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPPLSRVKREQLRKRRNNLLRRHNEFWLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAPPLSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQIFTYHSHPDTPPPSREDMKTRPKPTIVRTPRDYISATSAQSVGRDIPVFCAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.89
4 0.89
5 0.88
6 0.87
7 0.87
8 0.86
9 0.84
10 0.8
11 0.71
12 0.66
13 0.57
14 0.48
15 0.43
16 0.33
17 0.25
18 0.21
19 0.19
20 0.14
21 0.14
22 0.13
23 0.07
24 0.06
25 0.06
26 0.06
27 0.08
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.12
39 0.12
40 0.17
41 0.21
42 0.23
43 0.23
44 0.25
45 0.29
46 0.3
47 0.33
48 0.36
49 0.4
50 0.47
51 0.54
52 0.54
53 0.53
54 0.56
55 0.59
56 0.57
57 0.6
58 0.57
59 0.56
60 0.58
61 0.6
62 0.56
63 0.54
64 0.49
65 0.4
66 0.37
67 0.32
68 0.28
69 0.24
70 0.24
71 0.21
72 0.2
73 0.19
74 0.14
75 0.14
76 0.15
77 0.14