Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6TCG8

Protein Details
Accession A0A1V6TCG8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-91PPITRSSTSSRGKRQRRRPSATYVDYHydrophilic
NLS Segment(s)
PositionSequence
78-82KRQRR
Subcellular Location(s) mito 7plas 7, nucl 5, extr 4, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPISSMLEPRQSSGDNCPSTISSGGIAGIVIGSIAGTLLILWLWRIFRLPAAWSGGDTPDVGYRPPITRSSTSSRGKRQRRRPSATYVDYVEKPTTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.32
4 0.32
5 0.32
6 0.29
7 0.3
8 0.28
9 0.21
10 0.12
11 0.11
12 0.11
13 0.09
14 0.08
15 0.05
16 0.04
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.09
39 0.11
40 0.11
41 0.11
42 0.12
43 0.11
44 0.11
45 0.1
46 0.09
47 0.08
48 0.09
49 0.09
50 0.09
51 0.11
52 0.13
53 0.15
54 0.18
55 0.21
56 0.23
57 0.28
58 0.34
59 0.41
60 0.48
61 0.53
62 0.6
63 0.66
64 0.74
65 0.79
66 0.83
67 0.85
68 0.88
69 0.89
70 0.84
71 0.84
72 0.83
73 0.78
74 0.71
75 0.64
76 0.59
77 0.52
78 0.5