Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6SFU7

Protein Details
Accession A0A1V6SFU7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ILNVLAQRRYRQRKRERLQSLETRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
IPR020844  Circadian_clock_KaiA_N  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0007623  P:circadian rhythm  
PROSITE View protein in PROSITE  
PS51430  KAIA_N  
Amino Acid Sequences MSSQQISVPHGPDRQRILNVLAQRRYRQRKRERLQSLETRFDARLGGTDTMYASNGEIQLQQPMQPPLTSIDPIYDLYPDLMIGASNACLVPYESACNMSETSPSYVRNQFGINTILPYGMPWQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.4
4 0.39
5 0.38
6 0.42
7 0.45
8 0.45
9 0.44
10 0.49
11 0.57
12 0.64
13 0.68
14 0.72
15 0.75
16 0.79
17 0.84
18 0.88
19 0.87
20 0.83
21 0.83
22 0.82
23 0.77
24 0.71
25 0.63
26 0.55
27 0.46
28 0.39
29 0.31
30 0.21
31 0.17
32 0.14
33 0.14
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.09
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.1
49 0.11
50 0.12
51 0.12
52 0.11
53 0.12
54 0.12
55 0.14
56 0.13
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.07
79 0.07
80 0.1
81 0.1
82 0.12
83 0.13
84 0.14
85 0.14
86 0.13
87 0.14
88 0.15
89 0.19
90 0.2
91 0.21
92 0.25
93 0.29
94 0.29
95 0.3
96 0.28
97 0.25
98 0.25
99 0.27
100 0.22
101 0.2
102 0.19
103 0.17
104 0.15
105 0.15