Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6TS47

Protein Details
Accession A0A1V6TS47    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-64YTPKYEGKWKPKFKPKLRDCKEKYBasic
NLS Segment(s)
PositionSequence
48-81KWKPKFKPKLRDCKEKYEGWKKKMAWHAKEPKAP
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 7, pero 4
Family & Domain DBs
Amino Acid Sequences MAPISGLANDNTLSLRADKQYVVDMERELFLAKMLLGFIGYTPKYEGKWKPKFKPKLRDCKEKYEGWKKKMAWHAKEPKAPEPAHAARHISQAPDVNRITRDLTPEYMKMSTAAIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.17
5 0.16
6 0.17
7 0.21
8 0.21
9 0.21
10 0.2
11 0.18
12 0.18
13 0.17
14 0.17
15 0.12
16 0.1
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.08
27 0.08
28 0.09
29 0.11
30 0.12
31 0.13
32 0.2
33 0.27
34 0.33
35 0.44
36 0.52
37 0.59
38 0.68
39 0.77
40 0.8
41 0.84
42 0.82
43 0.84
44 0.82
45 0.84
46 0.78
47 0.78
48 0.73
49 0.67
50 0.67
51 0.67
52 0.67
53 0.6
54 0.63
55 0.54
56 0.57
57 0.6
58 0.61
59 0.55
60 0.58
61 0.65
62 0.64
63 0.68
64 0.64
65 0.61
66 0.59
67 0.53
68 0.45
69 0.43
70 0.4
71 0.4
72 0.38
73 0.37
74 0.31
75 0.36
76 0.35
77 0.27
78 0.26
79 0.29
80 0.28
81 0.31
82 0.3
83 0.28
84 0.28
85 0.29
86 0.3
87 0.25
88 0.28
89 0.25
90 0.29
91 0.3
92 0.31
93 0.32
94 0.29
95 0.27
96 0.23