Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6TI67

Protein Details
Accession A0A1V6TI67   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-87KPTGRVRKATKPTTKRKTASHydrophilic
NLS Segment(s)
PositionSequence
69-83PTGRVRKATKPTTKR
Subcellular Location(s) cyto 7, extr 7, cyto_nucl 6.5, nucl 4, mito 4, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MASTWDHERDKQLLVAILAVHSPLDFAAIAKAMGQGGSTAAVRQHVHALKARQEGTTKQSPTKDKTDKPTGRVRKATKPTTKRKTASATNPDKDFVVEGQNDYGEEPCPSPTKQRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.17
4 0.14
5 0.12
6 0.1
7 0.08
8 0.06
9 0.06
10 0.04
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.06
25 0.06
26 0.05
27 0.06
28 0.09
29 0.09
30 0.1
31 0.16
32 0.16
33 0.18
34 0.22
35 0.24
36 0.27
37 0.31
38 0.31
39 0.26
40 0.26
41 0.27
42 0.28
43 0.32
44 0.29
45 0.27
46 0.32
47 0.35
48 0.37
49 0.44
50 0.46
51 0.43
52 0.49
53 0.57
54 0.56
55 0.56
56 0.62
57 0.62
58 0.62
59 0.66
60 0.64
61 0.63
62 0.68
63 0.73
64 0.73
65 0.74
66 0.77
67 0.78
68 0.82
69 0.75
70 0.72
71 0.7
72 0.68
73 0.69
74 0.68
75 0.68
76 0.64
77 0.64
78 0.58
79 0.51
80 0.43
81 0.34
82 0.25
83 0.21
84 0.17
85 0.17
86 0.17
87 0.17
88 0.17
89 0.16
90 0.16
91 0.11
92 0.11
93 0.11
94 0.13
95 0.16
96 0.18
97 0.28