Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6S7K8

Protein Details
Accession A0A1V6S7K8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-67VESLRGKKYHILRKQRRTGAKVHydrophilic
155-175DYVHRVCAARKLRYRRTERPHBasic
NLS Segment(s)
PositionSequence
52-73KKYHILRKQRRTGAKVPGRSGK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSPRSTCGWPEWEEKNLLPWLDAHRDLSWKALSDAYYEEYQVDRSVESLRGKKYHILRKQRRTGAKVPGRSGKQNPPGDVRRSLVDSGSRSTMPDNTSAQRNIDKWFQTILAADPSQSGDSNKPAQTARSKIRCVTPAPLPYSPQRTRSSSWMWDYVHRVCAARKLRYRRTERPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.35
4 0.31
5 0.26
6 0.24
7 0.26
8 0.28
9 0.29
10 0.27
11 0.25
12 0.28
13 0.28
14 0.29
15 0.25
16 0.21
17 0.21
18 0.2
19 0.19
20 0.17
21 0.19
22 0.18
23 0.17
24 0.16
25 0.15
26 0.13
27 0.14
28 0.13
29 0.12
30 0.09
31 0.09
32 0.11
33 0.15
34 0.2
35 0.24
36 0.27
37 0.28
38 0.3
39 0.35
40 0.42
41 0.47
42 0.51
43 0.57
44 0.64
45 0.72
46 0.8
47 0.82
48 0.81
49 0.78
50 0.75
51 0.75
52 0.72
53 0.67
54 0.61
55 0.6
56 0.56
57 0.54
58 0.53
59 0.51
60 0.52
61 0.5
62 0.48
63 0.48
64 0.5
65 0.48
66 0.45
67 0.38
68 0.3
69 0.29
70 0.27
71 0.21
72 0.19
73 0.17
74 0.16
75 0.16
76 0.15
77 0.13
78 0.13
79 0.15
80 0.13
81 0.14
82 0.15
83 0.15
84 0.19
85 0.19
86 0.2
87 0.21
88 0.21
89 0.21
90 0.23
91 0.23
92 0.2
93 0.2
94 0.19
95 0.17
96 0.16
97 0.15
98 0.13
99 0.12
100 0.11
101 0.1
102 0.11
103 0.11
104 0.11
105 0.12
106 0.1
107 0.14
108 0.19
109 0.2
110 0.21
111 0.21
112 0.25
113 0.3
114 0.35
115 0.4
116 0.43
117 0.45
118 0.46
119 0.51
120 0.5
121 0.47
122 0.45
123 0.43
124 0.42
125 0.45
126 0.43
127 0.41
128 0.43
129 0.49
130 0.49
131 0.48
132 0.47
133 0.46
134 0.48
135 0.51
136 0.52
137 0.5
138 0.51
139 0.5
140 0.47
141 0.47
142 0.49
143 0.46
144 0.44
145 0.38
146 0.35
147 0.31
148 0.38
149 0.41
150 0.45
151 0.51
152 0.57
153 0.65
154 0.74
155 0.81