Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6SHM0

Protein Details
Accession A0A1V6SHM0   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-70PPEEKAMNSKEKRKKRKKERKYGEAQTAREBasic
NLS Segment(s)
PositionSequence
49-61SKEKRKKRKKERK
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MNPPNQIIDPDVGLYNGLRSTVPLFNLSTFRFELPEQSQPPPEEKAMNSKEKRKKRKKERKYGEAQTAREEYAAEEPTVEESAAGEPTAKEPAAEESAAGEPTAKEPAAEESATEESAAGEPAIDESATEESAAEFGTLNYVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.08
6 0.09
7 0.12
8 0.14
9 0.16
10 0.16
11 0.17
12 0.18
13 0.23
14 0.22
15 0.22
16 0.21
17 0.2
18 0.2
19 0.19
20 0.22
21 0.22
22 0.29
23 0.29
24 0.3
25 0.34
26 0.33
27 0.36
28 0.33
29 0.3
30 0.25
31 0.23
32 0.3
33 0.31
34 0.4
35 0.42
36 0.49
37 0.57
38 0.65
39 0.75
40 0.77
41 0.82
42 0.84
43 0.91
44 0.92
45 0.94
46 0.94
47 0.93
48 0.92
49 0.87
50 0.86
51 0.81
52 0.71
53 0.63
54 0.54
55 0.44
56 0.34
57 0.27
58 0.18
59 0.14
60 0.14
61 0.1
62 0.08
63 0.08
64 0.09
65 0.09
66 0.08
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.06
75 0.08
76 0.07
77 0.06
78 0.07
79 0.1
80 0.11
81 0.11
82 0.1
83 0.1
84 0.12
85 0.12
86 0.11
87 0.09
88 0.07
89 0.08
90 0.1
91 0.07
92 0.06
93 0.07
94 0.1
95 0.12
96 0.12
97 0.11
98 0.13
99 0.15
100 0.15
101 0.15
102 0.12
103 0.1
104 0.1
105 0.11
106 0.07
107 0.05
108 0.05
109 0.06
110 0.07
111 0.05
112 0.05
113 0.06
114 0.08
115 0.09
116 0.09
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.05
123 0.05
124 0.11