Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6U2I4

Protein Details
Accession A0A1V6U2I4    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
189-223SNIRGMSRSERKERIKRNERKQRSNEKRSNPARAKHydrophilic
NLS Segment(s)
PositionSequence
103-142KPLPVPKAPTKWELFARKKGIGKFSQKPGAAGMDKERRKK
192-223RGMSRSERKERIKRNERKQRSNEKRSNPARAK
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSDTEMANSVPTAAAGSKTERLPITVSKPTPYTFDLGHLLVNDPNPLELPADQTLNDSLKATARDGVQVLLNQLLTTCEIKTSVSDGVLLNLPAPNIHLPRHKPLPVPKAPTKWELFARKKGIGKFSQKPGAAGMDKERRKKLVYDEATGEWVPRWGYKGKNKEDENQWLVEVDEKKWKKEAEANAEGSNIRGMSRSERKERIKRNERKQRSNEKRSNPARAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.18
5 0.19
6 0.23
7 0.22
8 0.23
9 0.25
10 0.28
11 0.31
12 0.35
13 0.36
14 0.36
15 0.38
16 0.37
17 0.38
18 0.34
19 0.3
20 0.22
21 0.24
22 0.24
23 0.22
24 0.22
25 0.18
26 0.18
27 0.17
28 0.17
29 0.14
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.09
36 0.13
37 0.13
38 0.14
39 0.14
40 0.14
41 0.16
42 0.16
43 0.16
44 0.13
45 0.12
46 0.14
47 0.15
48 0.15
49 0.15
50 0.14
51 0.16
52 0.15
53 0.16
54 0.14
55 0.13
56 0.13
57 0.11
58 0.1
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.1
70 0.09
71 0.08
72 0.1
73 0.09
74 0.1
75 0.1
76 0.1
77 0.08
78 0.08
79 0.07
80 0.06
81 0.07
82 0.08
83 0.09
84 0.12
85 0.17
86 0.19
87 0.25
88 0.3
89 0.31
90 0.33
91 0.4
92 0.46
93 0.46
94 0.51
95 0.51
96 0.5
97 0.51
98 0.51
99 0.45
100 0.38
101 0.39
102 0.42
103 0.42
104 0.43
105 0.45
106 0.45
107 0.47
108 0.47
109 0.46
110 0.43
111 0.46
112 0.45
113 0.47
114 0.5
115 0.46
116 0.44
117 0.39
118 0.36
119 0.29
120 0.24
121 0.25
122 0.28
123 0.32
124 0.37
125 0.39
126 0.37
127 0.38
128 0.4
129 0.41
130 0.42
131 0.42
132 0.39
133 0.4
134 0.38
135 0.39
136 0.36
137 0.29
138 0.18
139 0.15
140 0.13
141 0.1
142 0.12
143 0.14
144 0.22
145 0.3
146 0.4
147 0.46
148 0.55
149 0.57
150 0.62
151 0.64
152 0.66
153 0.6
154 0.51
155 0.43
156 0.35
157 0.32
158 0.3
159 0.25
160 0.18
161 0.26
162 0.26
163 0.28
164 0.33
165 0.33
166 0.32
167 0.38
168 0.45
169 0.44
170 0.5
171 0.51
172 0.47
173 0.47
174 0.43
175 0.36
176 0.28
177 0.19
178 0.12
179 0.1
180 0.11
181 0.19
182 0.29
183 0.35
184 0.42
185 0.52
186 0.62
187 0.7
188 0.79
189 0.82
190 0.83
191 0.87
192 0.89
193 0.92
194 0.92
195 0.93
196 0.93
197 0.93
198 0.94
199 0.94
200 0.93
201 0.91
202 0.91
203 0.88