Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FCN9

Protein Details
Accession A0A0C4FCN9    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
17-37FEYSKEKWDKKHKIPSFKIGDHydrophilic
NLS Segment(s)
PositionSequence
127-138IHKILKDKKIRG
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MLDKARKQAQQRMDNAFEYSKEKWDKKHKIPSFKIGDLVLISTPNFTNIKGPKKLRNAFVGPFVVKALHGPNAVEVELYGELEKKHPTFPVSLLKHYNESDAELFPLRKEIPEAEVPPLEESEEKKIHKILKDKKIRGEKDKLYLVRYRNPIHHLREWLPEKDIKDADKYIRKFKNSKHKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.56
3 0.49
4 0.41
5 0.37
6 0.32
7 0.32
8 0.36
9 0.38
10 0.44
11 0.54
12 0.62
13 0.67
14 0.77
15 0.76
16 0.79
17 0.82
18 0.83
19 0.79
20 0.7
21 0.63
22 0.52
23 0.45
24 0.34
25 0.29
26 0.2
27 0.13
28 0.11
29 0.1
30 0.1
31 0.12
32 0.12
33 0.11
34 0.17
35 0.23
36 0.31
37 0.38
38 0.42
39 0.48
40 0.57
41 0.62
42 0.59
43 0.6
44 0.56
45 0.5
46 0.5
47 0.44
48 0.34
49 0.29
50 0.26
51 0.19
52 0.14
53 0.14
54 0.11
55 0.11
56 0.11
57 0.1
58 0.11
59 0.12
60 0.12
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.08
70 0.1
71 0.09
72 0.1
73 0.11
74 0.12
75 0.13
76 0.16
77 0.24
78 0.24
79 0.26
80 0.28
81 0.28
82 0.29
83 0.28
84 0.27
85 0.18
86 0.17
87 0.16
88 0.13
89 0.13
90 0.12
91 0.12
92 0.1
93 0.12
94 0.1
95 0.09
96 0.1
97 0.1
98 0.12
99 0.16
100 0.18
101 0.18
102 0.19
103 0.19
104 0.18
105 0.18
106 0.15
107 0.12
108 0.12
109 0.17
110 0.21
111 0.21
112 0.22
113 0.26
114 0.3
115 0.34
116 0.42
117 0.46
118 0.51
119 0.61
120 0.65
121 0.7
122 0.76
123 0.77
124 0.76
125 0.75
126 0.7
127 0.67
128 0.7
129 0.63
130 0.57
131 0.56
132 0.52
133 0.51
134 0.52
135 0.49
136 0.46
137 0.5
138 0.54
139 0.55
140 0.56
141 0.55
142 0.51
143 0.57
144 0.57
145 0.53
146 0.5
147 0.47
148 0.42
149 0.43
150 0.43
151 0.35
152 0.35
153 0.37
154 0.42
155 0.47
156 0.5
157 0.53
158 0.58
159 0.63
160 0.65
161 0.7