Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FB03

Protein Details
Accession A0A0C4FB03    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-125TKESKERDPKKPYKIPKIDRTKPAASGSKPKPYERKPKKRENKWKETFRMARVBasic
NLS Segment(s)
PositionSequence
72-117PTKESKERDPKKPYKIPKIDRTKPAASGSKPKPYERKPKKRENKWK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences PQQSAGGRDSDLQSDEGRLPECQELRRDGLTQIVPRAGNLVVLGCTEVPPSDGWNPYTERKHIKVLENNKQPTKESKERDPKKPYKIPKIDRTKPAASGSKPKPYERKPKKRENKWKETFRMARVLMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.19
5 0.17
6 0.18
7 0.22
8 0.24
9 0.25
10 0.27
11 0.29
12 0.31
13 0.33
14 0.32
15 0.26
16 0.29
17 0.29
18 0.28
19 0.26
20 0.26
21 0.23
22 0.22
23 0.23
24 0.17
25 0.14
26 0.11
27 0.1
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.08
38 0.11
39 0.12
40 0.13
41 0.15
42 0.18
43 0.23
44 0.25
45 0.26
46 0.29
47 0.3
48 0.36
49 0.37
50 0.41
51 0.43
52 0.49
53 0.55
54 0.58
55 0.59
56 0.55
57 0.52
58 0.48
59 0.46
60 0.46
61 0.45
62 0.41
63 0.47
64 0.56
65 0.62
66 0.7
67 0.74
68 0.73
69 0.74
70 0.78
71 0.77
72 0.77
73 0.81
74 0.8
75 0.8
76 0.82
77 0.8
78 0.79
79 0.77
80 0.69
81 0.62
82 0.6
83 0.56
84 0.48
85 0.51
86 0.49
87 0.52
88 0.53
89 0.55
90 0.59
91 0.61
92 0.7
93 0.71
94 0.77
95 0.77
96 0.85
97 0.9
98 0.92
99 0.94
100 0.94
101 0.93
102 0.92
103 0.93
104 0.89
105 0.89
106 0.84
107 0.77
108 0.75
109 0.65
110 0.56
111 0.5
112 0.47
113 0.37
114 0.33
115 0.29