Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DFD2

Protein Details
Accession A0A0C4DFD2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-75KSPPTPPKPKPRKSTVPKRKASBasic
NLS Segment(s)
PositionSequence
31-75KPKKTTSSNKTPSKKSSKLAPKAKSPPTPPKPKPRKSTVPKRKAS
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MTSLTKNFHALGPRRSGTGRSSTPAVTSGSKPKKTTSSNKTPSKKSSKLAPKAKSPPTPPKPKPRKSTVPKRKASARILDSNDEQESGVGEVAQSNAVSIDSESETSNSSVAVPVTRKPTVQLGPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.42
4 0.37
5 0.39
6 0.36
7 0.31
8 0.33
9 0.31
10 0.3
11 0.29
12 0.28
13 0.22
14 0.23
15 0.3
16 0.36
17 0.4
18 0.41
19 0.43
20 0.48
21 0.53
22 0.6
23 0.58
24 0.61
25 0.66
26 0.74
27 0.77
28 0.75
29 0.77
30 0.76
31 0.72
32 0.64
33 0.64
34 0.64
35 0.68
36 0.71
37 0.66
38 0.65
39 0.69
40 0.72
41 0.68
42 0.65
43 0.66
44 0.65
45 0.72
46 0.69
47 0.72
48 0.76
49 0.78
50 0.79
51 0.76
52 0.78
53 0.77
54 0.83
55 0.82
56 0.82
57 0.78
58 0.76
59 0.76
60 0.73
61 0.68
62 0.65
63 0.59
64 0.55
65 0.53
66 0.52
67 0.45
68 0.4
69 0.35
70 0.27
71 0.22
72 0.14
73 0.12
74 0.09
75 0.08
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.07
88 0.07
89 0.09
90 0.09
91 0.1
92 0.11
93 0.12
94 0.12
95 0.1
96 0.09
97 0.09
98 0.1
99 0.13
100 0.13
101 0.17
102 0.23
103 0.25
104 0.25
105 0.26
106 0.34
107 0.35