Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F1N1

Protein Details
Accession A0A0C4F1N1   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-43FVKLCREKNCLKPHNVKRNVKTRWNSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences LSNCPKLNKSPNSKALFVKLCREKNCLKPHNVKRNVKTRWNSTLMQLNSILRCSGAILEWQKDKRHGLQREHLINQNDIDLAKDLAEVLQPFDEITLQVSTRGGAQIAEVVVYIDQITGHLSNVISDKESRYPATLRNACRAGIQLTNKYYTLTDCSPLYRVAMSLSFSLFYCWSFDSDSTLFLVLHPCSRMNILNSPSGTGMDFRSYPTCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.64
4 0.57
5 0.57
6 0.57
7 0.6
8 0.59
9 0.62
10 0.61
11 0.62
12 0.7
13 0.69
14 0.68
15 0.71
16 0.78
17 0.83
18 0.86
19 0.86
20 0.84
21 0.86
22 0.85
23 0.84
24 0.81
25 0.77
26 0.75
27 0.7
28 0.63
29 0.57
30 0.58
31 0.48
32 0.43
33 0.38
34 0.33
35 0.28
36 0.28
37 0.23
38 0.14
39 0.13
40 0.11
41 0.1
42 0.07
43 0.12
44 0.14
45 0.17
46 0.23
47 0.26
48 0.28
49 0.31
50 0.34
51 0.37
52 0.44
53 0.49
54 0.5
55 0.55
56 0.61
57 0.63
58 0.63
59 0.6
60 0.53
61 0.46
62 0.39
63 0.31
64 0.23
65 0.17
66 0.15
67 0.1
68 0.08
69 0.07
70 0.06
71 0.06
72 0.05
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.05
91 0.04
92 0.04
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.08
111 0.08
112 0.08
113 0.08
114 0.1
115 0.12
116 0.14
117 0.14
118 0.15
119 0.17
120 0.2
121 0.3
122 0.34
123 0.33
124 0.38
125 0.38
126 0.36
127 0.35
128 0.33
129 0.25
130 0.25
131 0.26
132 0.25
133 0.26
134 0.28
135 0.27
136 0.26
137 0.24
138 0.2
139 0.21
140 0.17
141 0.18
142 0.17
143 0.18
144 0.19
145 0.19
146 0.19
147 0.14
148 0.13
149 0.12
150 0.12
151 0.12
152 0.12
153 0.12
154 0.11
155 0.11
156 0.13
157 0.11
158 0.1
159 0.11
160 0.11
161 0.12
162 0.13
163 0.13
164 0.17
165 0.17
166 0.18
167 0.17
168 0.17
169 0.15
170 0.14
171 0.18
172 0.13
173 0.15
174 0.16
175 0.16
176 0.17
177 0.2
178 0.23
179 0.23
180 0.29
181 0.29
182 0.34
183 0.34
184 0.34
185 0.32
186 0.29
187 0.25
188 0.19
189 0.19
190 0.17
191 0.17
192 0.18