Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FD04

Protein Details
Accession A0A0C4FD04   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-26AFEYSKEKWDKKHKVPSFKIGDLHydrophilic
NLS Segment(s)
PositionSequence
117-125KILKDKKIR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MDNAFEYSKEKWDKKHKVPSFKIGDLVLISTTNFTNIKGPKKLRNAFVGPFVVKALHGPNAVEVELYGELEKKHPTFPVSLLKHYNESDAELFPLSKEIPEAEVPPLEESEEKKIHKILKDKKIRGEKDKLYLVRYRNPIHEDEWLPEKDIKDADKYLRRFKNSKHKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.78
3 0.78
4 0.81
5 0.84
6 0.84
7 0.81
8 0.72
9 0.65
10 0.54
11 0.47
12 0.36
13 0.3
14 0.21
15 0.13
16 0.11
17 0.1
18 0.09
19 0.11
20 0.1
21 0.1
22 0.16
23 0.21
24 0.28
25 0.35
26 0.4
27 0.46
28 0.56
29 0.61
30 0.59
31 0.61
32 0.58
33 0.52
34 0.52
35 0.47
36 0.37
37 0.31
38 0.27
39 0.2
40 0.16
41 0.15
42 0.12
43 0.12
44 0.11
45 0.11
46 0.12
47 0.13
48 0.12
49 0.11
50 0.09
51 0.08
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.08
58 0.11
59 0.1
60 0.11
61 0.12
62 0.13
63 0.14
64 0.17
65 0.25
66 0.25
67 0.27
68 0.29
69 0.29
70 0.3
71 0.29
72 0.27
73 0.17
74 0.17
75 0.15
76 0.12
77 0.12
78 0.09
79 0.09
80 0.08
81 0.09
82 0.07
83 0.05
84 0.06
85 0.05
86 0.07
87 0.08
88 0.09
89 0.1
90 0.1
91 0.11
92 0.11
93 0.11
94 0.1
95 0.1
96 0.11
97 0.16
98 0.2
99 0.2
100 0.21
101 0.25
102 0.29
103 0.33
104 0.41
105 0.45
106 0.51
107 0.61
108 0.64
109 0.69
110 0.75
111 0.77
112 0.75
113 0.75
114 0.7
115 0.66
116 0.69
117 0.62
118 0.56
119 0.55
120 0.52
121 0.5
122 0.52
123 0.48
124 0.46
125 0.47
126 0.46
127 0.43
128 0.45
129 0.39
130 0.36
131 0.38
132 0.33
133 0.33
134 0.33
135 0.31
136 0.27
137 0.28
138 0.27
139 0.26
140 0.3
141 0.36
142 0.42
143 0.47
144 0.54
145 0.59
146 0.64
147 0.65
148 0.7