Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BCH6

Protein Details
Accession G3BCH6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAERKKAVRKKKDPDAPKRSLSBasic
62-89EKIPYEKKANDDKKRYEKQKAEYAKKNSHydrophilic
NLS Segment(s)
PositionSequence
4-18RKKAVRKKKDPDAPK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG cten:CANTEDRAFT_110112  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAERKKAVRKKKDPDAPKRSLSAYMFFANDNRDIVRAENPGIAFGQVGRLLGERWKALTADEKIPYEKKANDDKKRYEKQKAEYAKKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.85
4 0.78
5 0.71
6 0.62
7 0.58
8 0.49
9 0.41
10 0.35
11 0.3
12 0.26
13 0.24
14 0.23
15 0.19
16 0.18
17 0.16
18 0.13
19 0.12
20 0.12
21 0.12
22 0.14
23 0.13
24 0.13
25 0.14
26 0.14
27 0.13
28 0.13
29 0.11
30 0.08
31 0.07
32 0.07
33 0.05
34 0.06
35 0.05
36 0.06
37 0.06
38 0.08
39 0.1
40 0.09
41 0.09
42 0.1
43 0.1
44 0.11
45 0.17
46 0.19
47 0.22
48 0.24
49 0.25
50 0.27
51 0.29
52 0.31
53 0.29
54 0.29
55 0.3
56 0.39
57 0.48
58 0.55
59 0.62
60 0.69
61 0.74
62 0.82
63 0.84
64 0.84
65 0.82
66 0.79
67 0.81
68 0.82
69 0.81