Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F9R1

Protein Details
Accession A0A0C4F9R1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
156-181SNSTAKKQVKTTKGNRKPRKTTAEDEHydrophilic
NLS Segment(s)
PositionSequence
171-173RKP
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MFHENSIPYSDVAKLINTWQTSGLISLSGLVYRSKLVFDKDTPPPLHLNFHIEFAGASSEAEAQGEEFQATTNWPFKIEINRVPSSIAGADPHTSWVLYSRVWTPSEEEYVDQAIKKIVKDNPDASGDIPFKELKSILNVSHTSTSIAHQGPTEESNSTAKKQVKTTKGNRKPRKTTAEDEDSEGESDIAKIDEGEDPVLEEDESFCPWVKQTLLINRLINQERIVKINLWTTMPLKLKMRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.22
4 0.21
5 0.21
6 0.2
7 0.21
8 0.2
9 0.2
10 0.16
11 0.11
12 0.1
13 0.1
14 0.09
15 0.08
16 0.09
17 0.08
18 0.09
19 0.1
20 0.11
21 0.12
22 0.14
23 0.18
24 0.22
25 0.25
26 0.31
27 0.36
28 0.43
29 0.42
30 0.42
31 0.42
32 0.4
33 0.41
34 0.36
35 0.35
36 0.28
37 0.29
38 0.26
39 0.22
40 0.2
41 0.15
42 0.15
43 0.09
44 0.08
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.06
52 0.07
53 0.06
54 0.05
55 0.06
56 0.06
57 0.07
58 0.09
59 0.12
60 0.12
61 0.13
62 0.14
63 0.16
64 0.24
65 0.28
66 0.31
67 0.35
68 0.36
69 0.35
70 0.34
71 0.32
72 0.25
73 0.21
74 0.15
75 0.09
76 0.09
77 0.1
78 0.09
79 0.1
80 0.09
81 0.08
82 0.08
83 0.1
84 0.1
85 0.09
86 0.1
87 0.12
88 0.14
89 0.15
90 0.16
91 0.16
92 0.16
93 0.18
94 0.17
95 0.15
96 0.14
97 0.14
98 0.14
99 0.11
100 0.1
101 0.1
102 0.11
103 0.1
104 0.14
105 0.15
106 0.19
107 0.22
108 0.23
109 0.24
110 0.24
111 0.25
112 0.2
113 0.22
114 0.19
115 0.16
116 0.16
117 0.14
118 0.12
119 0.12
120 0.12
121 0.08
122 0.11
123 0.13
124 0.12
125 0.16
126 0.16
127 0.17
128 0.19
129 0.18
130 0.16
131 0.14
132 0.15
133 0.15
134 0.15
135 0.14
136 0.13
137 0.13
138 0.13
139 0.14
140 0.14
141 0.1
142 0.11
143 0.15
144 0.17
145 0.17
146 0.23
147 0.26
148 0.28
149 0.35
150 0.42
151 0.47
152 0.55
153 0.64
154 0.69
155 0.74
156 0.82
157 0.86
158 0.88
159 0.87
160 0.87
161 0.86
162 0.81
163 0.78
164 0.75
165 0.72
166 0.63
167 0.58
168 0.51
169 0.42
170 0.36
171 0.29
172 0.21
173 0.13
174 0.12
175 0.09
176 0.07
177 0.06
178 0.05
179 0.06
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.1
186 0.11
187 0.09
188 0.07
189 0.08
190 0.09
191 0.1
192 0.11
193 0.11
194 0.11
195 0.11
196 0.15
197 0.13
198 0.17
199 0.23
200 0.31
201 0.35
202 0.4
203 0.41
204 0.42
205 0.49
206 0.47
207 0.42
208 0.36
209 0.38
210 0.34
211 0.36
212 0.35
213 0.29
214 0.29
215 0.32
216 0.32
217 0.27
218 0.28
219 0.26
220 0.32
221 0.34
222 0.36
223 0.39