Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F6H9

Protein Details
Accession A0A0C4F6H9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-21EEARKKMKKARETSVRYWDRBasic
NLS Segment(s)
PositionSequence
5-14RKKMKKARET
21-29RRLAHRLRK
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.333, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MEEARKKMKKARETSVRYWDRRLAHRLRKPLKSGDLVLVYNKALETQWGNLFKHKWNGPYRIVKQVKNGPYVLAELDGTVLTRMFAANHVKRFYPRGESQAEEGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.8
4 0.73
5 0.7
6 0.66
7 0.61
8 0.59
9 0.6
10 0.59
11 0.61
12 0.65
13 0.71
14 0.73
15 0.73
16 0.71
17 0.69
18 0.64
19 0.58
20 0.52
21 0.46
22 0.4
23 0.34
24 0.3
25 0.25
26 0.19
27 0.15
28 0.14
29 0.1
30 0.07
31 0.07
32 0.08
33 0.09
34 0.13
35 0.17
36 0.18
37 0.2
38 0.22
39 0.23
40 0.27
41 0.27
42 0.3
43 0.32
44 0.37
45 0.4
46 0.48
47 0.48
48 0.53
49 0.56
50 0.5
51 0.51
52 0.54
53 0.52
54 0.47
55 0.44
56 0.34
57 0.31
58 0.3
59 0.23
60 0.16
61 0.11
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.05
68 0.04
69 0.05
70 0.05
71 0.05
72 0.09
73 0.19
74 0.24
75 0.3
76 0.32
77 0.34
78 0.37
79 0.41
80 0.41
81 0.4
82 0.38
83 0.39
84 0.42
85 0.42
86 0.44