Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FAX3

Protein Details
Accession A0A0C4FAX3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-37GLTPNQRKRKSSKPNPEKGQATHydrophilic
NLS Segment(s)
PositionSequence
22-30RKRKSSKPN
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGSLEADSRSGCQDLGLTPNQRKRKSSKPNPEKGQATSSIDKEPKRTKHDRQPISSLPSDASPDLIGTSLRDRITNPTIGDNRSSGTLVAHTSGTADTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.21
4 0.24
5 0.3
6 0.39
7 0.48
8 0.5
9 0.54
10 0.56
11 0.61
12 0.67
13 0.71
14 0.74
15 0.76
16 0.83
17 0.84
18 0.85
19 0.78
20 0.69
21 0.62
22 0.54
23 0.48
24 0.41
25 0.36
26 0.34
27 0.34
28 0.32
29 0.35
30 0.39
31 0.4
32 0.45
33 0.51
34 0.54
35 0.61
36 0.7
37 0.7
38 0.67
39 0.67
40 0.62
41 0.6
42 0.52
43 0.42
44 0.33
45 0.27
46 0.24
47 0.17
48 0.14
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.06
55 0.08
56 0.12
57 0.12
58 0.13
59 0.14
60 0.2
61 0.23
62 0.26
63 0.25
64 0.29
65 0.31
66 0.33
67 0.34
68 0.28
69 0.26
70 0.23
71 0.23
72 0.15
73 0.13
74 0.13
75 0.12
76 0.13
77 0.12
78 0.1
79 0.11
80 0.11