Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F4R7

Protein Details
Accession A0A0C4F4R7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-130FGAVGKKKKEPTKKPEPTQEEEBasic
NLS Segment(s)
PositionSequence
114-122KKKKEPTKK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.333, mito_nucl 10.332, mito 7.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MSCFPFPQPPPRICWVQSDCTLTLPAQDAAPASPQAPAVEAVKASPAKAAAAPAETPEEAKVEKKEKSPKVSRSIFLSLSLPELSTHLFMLLLVQDLAKLAQQFSSRLFGAVGKKKKEPTKKPEPTQEEEAESAAPAEIPANTTPEVLQAATKPAPVIAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.48
4 0.5
5 0.49
6 0.44
7 0.4
8 0.39
9 0.29
10 0.26
11 0.22
12 0.18
13 0.13
14 0.13
15 0.12
16 0.11
17 0.13
18 0.12
19 0.1
20 0.1
21 0.11
22 0.1
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.09
29 0.13
30 0.13
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.12
37 0.09
38 0.1
39 0.1
40 0.1
41 0.12
42 0.11
43 0.11
44 0.1
45 0.11
46 0.1
47 0.12
48 0.15
49 0.18
50 0.21
51 0.27
52 0.36
53 0.41
54 0.49
55 0.55
56 0.58
57 0.62
58 0.63
59 0.58
60 0.54
61 0.51
62 0.42
63 0.35
64 0.29
65 0.2
66 0.18
67 0.17
68 0.11
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.08
89 0.09
90 0.1
91 0.12
92 0.15
93 0.14
94 0.14
95 0.14
96 0.15
97 0.22
98 0.29
99 0.35
100 0.35
101 0.39
102 0.46
103 0.54
104 0.62
105 0.64
106 0.65
107 0.7
108 0.76
109 0.8
110 0.84
111 0.83
112 0.78
113 0.75
114 0.69
115 0.6
116 0.51
117 0.43
118 0.33
119 0.26
120 0.19
121 0.12
122 0.09
123 0.06
124 0.06
125 0.05
126 0.08
127 0.08
128 0.11
129 0.12
130 0.12
131 0.12
132 0.13
133 0.15
134 0.12
135 0.13
136 0.12
137 0.17
138 0.17
139 0.18
140 0.16
141 0.15
142 0.16