Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F038

Protein Details
Accession A0A0C4F038    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-40GAPSRDFSRHRKPPQKAASQRRPAPSHydrophilic
NLS Segment(s)
PositionSequence
24-37HRKPPQKAASQRRP
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRTVYDTDVRVCPVGAPSRDFSRHRKPPQKAASQRRPAPSSSRANRPQGMVFSVGDLPQELQKIGGSELPPAPDSLPAPIPARTARGMGVVFNVNELPQELKELQAQGSKAKPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.26
4 0.28
5 0.33
6 0.39
7 0.42
8 0.46
9 0.49
10 0.57
11 0.65
12 0.71
13 0.72
14 0.76
15 0.82
16 0.85
17 0.84
18 0.85
19 0.85
20 0.84
21 0.84
22 0.8
23 0.72
24 0.64
25 0.59
26 0.56
27 0.56
28 0.51
29 0.55
30 0.54
31 0.57
32 0.56
33 0.52
34 0.46
35 0.37
36 0.33
37 0.25
38 0.19
39 0.15
40 0.14
41 0.12
42 0.1
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.09
53 0.08
54 0.1
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.11
62 0.11
63 0.11
64 0.12
65 0.14
66 0.14
67 0.16
68 0.16
69 0.18
70 0.17
71 0.17
72 0.15
73 0.16
74 0.16
75 0.14
76 0.15
77 0.15
78 0.14
79 0.14
80 0.13
81 0.1
82 0.11
83 0.11
84 0.11
85 0.09
86 0.14
87 0.13
88 0.15
89 0.18
90 0.19
91 0.2
92 0.22
93 0.23
94 0.24