Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EZ66

Protein Details
Accession A0A0C4EZ66    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
160-179AAHPLGHQPKRTKKSKPAIKBasic
NLS Segment(s)
PositionSequence
156-179KRRGAAHPLGHQPKRTKKSKPAIK
Subcellular Location(s) nucl 23.5, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSDLLNAKKPYKCSVEGCQKSFALQSALTIHKRTHTGLKPFKCSVKGCSAQFSESSNLSKHMRTHSLVKKFECTICGRRFTRSDQLTRHLKSESIHLHLNNTSVDHNHNHDDVEEEDEDDPDVGLDSQGGDVDCSSTLHQARPSSRPQISASAQEKRRGAAHPLGHQPKRTKKSKPAIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.62
4 0.62
5 0.6
6 0.53
7 0.49
8 0.45
9 0.37
10 0.28
11 0.2
12 0.19
13 0.19
14 0.25
15 0.26
16 0.26
17 0.25
18 0.26
19 0.28
20 0.29
21 0.33
22 0.36
23 0.43
24 0.51
25 0.56
26 0.6
27 0.61
28 0.63
29 0.6
30 0.54
31 0.49
32 0.49
33 0.49
34 0.43
35 0.46
36 0.42
37 0.38
38 0.37
39 0.34
40 0.27
41 0.22
42 0.23
43 0.18
44 0.2
45 0.2
46 0.21
47 0.22
48 0.24
49 0.26
50 0.26
51 0.35
52 0.4
53 0.47
54 0.49
55 0.48
56 0.46
57 0.44
58 0.43
59 0.37
60 0.34
61 0.34
62 0.33
63 0.39
64 0.36
65 0.38
66 0.4
67 0.41
68 0.45
69 0.41
70 0.42
71 0.38
72 0.44
73 0.47
74 0.46
75 0.42
76 0.34
77 0.31
78 0.26
79 0.29
80 0.25
81 0.21
82 0.23
83 0.21
84 0.23
85 0.22
86 0.23
87 0.16
88 0.14
89 0.12
90 0.1
91 0.13
92 0.12
93 0.15
94 0.16
95 0.16
96 0.15
97 0.14
98 0.15
99 0.14
100 0.15
101 0.13
102 0.12
103 0.12
104 0.12
105 0.12
106 0.1
107 0.09
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.08
123 0.12
124 0.13
125 0.16
126 0.2
127 0.24
128 0.28
129 0.32
130 0.38
131 0.41
132 0.41
133 0.42
134 0.41
135 0.43
136 0.42
137 0.46
138 0.46
139 0.47
140 0.49
141 0.52
142 0.5
143 0.45
144 0.46
145 0.4
146 0.4
147 0.39
148 0.41
149 0.42
150 0.52
151 0.6
152 0.61
153 0.65
154 0.68
155 0.71
156 0.74
157 0.75
158 0.74
159 0.75