Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3B5C6

Protein Details
Accession G3B5C6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40TKHHSFKSSTKVKPSNKRFKPARQLISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG cten:CANTEDRAFT_106968  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MADLELSQLSYVTTKHHSFKSSTKVKPSNKRFKPARQLISDEIKYLQTKSLKFDTPTLTSITAPPTLKPSKKYCDITGLEGKYRSPSNNLRFYNVEIYQEVIRHMPPGLDQEYLSLRGANVILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.29
4 0.32
5 0.35
6 0.41
7 0.48
8 0.52
9 0.53
10 0.58
11 0.64
12 0.7
13 0.77
14 0.81
15 0.82
16 0.79
17 0.84
18 0.82
19 0.82
20 0.84
21 0.83
22 0.79
23 0.72
24 0.7
25 0.65
26 0.66
27 0.56
28 0.46
29 0.37
30 0.32
31 0.28
32 0.24
33 0.23
34 0.19
35 0.2
36 0.23
37 0.26
38 0.26
39 0.27
40 0.3
41 0.29
42 0.27
43 0.28
44 0.25
45 0.22
46 0.19
47 0.19
48 0.17
49 0.17
50 0.14
51 0.13
52 0.18
53 0.22
54 0.24
55 0.28
56 0.32
57 0.34
58 0.42
59 0.45
60 0.4
61 0.44
62 0.43
63 0.43
64 0.45
65 0.41
66 0.35
67 0.33
68 0.31
69 0.26
70 0.26
71 0.22
72 0.21
73 0.29
74 0.34
75 0.43
76 0.44
77 0.45
78 0.45
79 0.47
80 0.47
81 0.39
82 0.34
83 0.25
84 0.26
85 0.23
86 0.22
87 0.2
88 0.15
89 0.14
90 0.13
91 0.13
92 0.11
93 0.11
94 0.16
95 0.17
96 0.17
97 0.16
98 0.18
99 0.21
100 0.22
101 0.22
102 0.17
103 0.14
104 0.15