Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EXC2

Protein Details
Accession A0A0C4EXC2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
217-239LIPPPHPRLKKRHRPPQAPMLHHBasic
NLS Segment(s)
PositionSequence
223-230PRLKKRHR
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEDPPPPTNSAPLPSSNAERDRDTLSQTPPPTEQDITRNLPNGSLPAPSFEQFVLQKAPSAPPASLDPLESILPTKLQEITAEELDQSIAAAEQSSQAILSLKLPTAASARPKTWPHLLLKENEVIDLLHKPPASTSTLPAPNPTHQPSIPTTNEPSPWADGPQPASSNVPSSSTPGIQQPTTDITSTKQPPNTTVNNPGPMFPFTASVHPPSPGLLIPPPHPRLKKRHRPPQAPMLHHAHLTPIMTQLHQHTTHLANIIQPGRSIMSFYRECSGRWDWSTGRFPQELGAAPQYCSQEKIPLAGCGALLWPDLLTQPPPSEYRDELLQVEPIDQLAWGALLFPPTLQTPPRTAAPKPPSPQSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.4
4 0.42
5 0.41
6 0.4
7 0.4
8 0.4
9 0.39
10 0.4
11 0.38
12 0.38
13 0.42
14 0.41
15 0.42
16 0.39
17 0.41
18 0.4
19 0.37
20 0.36
21 0.34
22 0.39
23 0.41
24 0.42
25 0.42
26 0.37
27 0.36
28 0.33
29 0.3
30 0.24
31 0.22
32 0.18
33 0.18
34 0.21
35 0.2
36 0.21
37 0.18
38 0.22
39 0.19
40 0.22
41 0.22
42 0.2
43 0.22
44 0.22
45 0.25
46 0.24
47 0.25
48 0.22
49 0.2
50 0.23
51 0.25
52 0.23
53 0.22
54 0.18
55 0.18
56 0.19
57 0.17
58 0.15
59 0.11
60 0.12
61 0.11
62 0.12
63 0.11
64 0.12
65 0.12
66 0.14
67 0.17
68 0.17
69 0.17
70 0.15
71 0.14
72 0.14
73 0.12
74 0.09
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.09
88 0.09
89 0.09
90 0.1
91 0.1
92 0.11
93 0.13
94 0.15
95 0.21
96 0.23
97 0.24
98 0.29
99 0.31
100 0.34
101 0.37
102 0.4
103 0.37
104 0.42
105 0.44
106 0.41
107 0.42
108 0.42
109 0.36
110 0.3
111 0.26
112 0.18
113 0.16
114 0.15
115 0.13
116 0.12
117 0.12
118 0.12
119 0.12
120 0.15
121 0.18
122 0.16
123 0.17
124 0.21
125 0.26
126 0.26
127 0.29
128 0.3
129 0.28
130 0.32
131 0.34
132 0.3
133 0.26
134 0.29
135 0.28
136 0.32
137 0.31
138 0.28
139 0.28
140 0.27
141 0.28
142 0.26
143 0.24
144 0.2
145 0.18
146 0.17
147 0.16
148 0.15
149 0.17
150 0.17
151 0.16
152 0.15
153 0.16
154 0.15
155 0.15
156 0.14
157 0.13
158 0.12
159 0.13
160 0.14
161 0.13
162 0.14
163 0.14
164 0.16
165 0.14
166 0.13
167 0.12
168 0.14
169 0.15
170 0.14
171 0.11
172 0.11
173 0.18
174 0.22
175 0.24
176 0.24
177 0.23
178 0.27
179 0.32
180 0.35
181 0.31
182 0.36
183 0.35
184 0.38
185 0.37
186 0.35
187 0.31
188 0.27
189 0.25
190 0.17
191 0.17
192 0.13
193 0.16
194 0.16
195 0.17
196 0.17
197 0.16
198 0.16
199 0.13
200 0.13
201 0.11
202 0.11
203 0.11
204 0.12
205 0.15
206 0.23
207 0.26
208 0.31
209 0.35
210 0.39
211 0.48
212 0.57
213 0.65
214 0.68
215 0.75
216 0.8
217 0.84
218 0.84
219 0.84
220 0.82
221 0.74
222 0.69
223 0.65
224 0.55
225 0.47
226 0.41
227 0.31
228 0.24
229 0.21
230 0.16
231 0.13
232 0.12
233 0.12
234 0.13
235 0.15
236 0.19
237 0.19
238 0.19
239 0.19
240 0.2
241 0.21
242 0.22
243 0.19
244 0.15
245 0.19
246 0.21
247 0.18
248 0.17
249 0.16
250 0.15
251 0.15
252 0.15
253 0.12
254 0.17
255 0.17
256 0.19
257 0.23
258 0.22
259 0.23
260 0.27
261 0.31
262 0.29
263 0.3
264 0.33
265 0.3
266 0.36
267 0.42
268 0.39
269 0.4
270 0.35
271 0.33
272 0.3
273 0.31
274 0.26
275 0.24
276 0.27
277 0.23
278 0.23
279 0.27
280 0.28
281 0.26
282 0.27
283 0.24
284 0.24
285 0.24
286 0.27
287 0.24
288 0.23
289 0.23
290 0.21
291 0.2
292 0.14
293 0.14
294 0.11
295 0.09
296 0.08
297 0.07
298 0.07
299 0.08
300 0.09
301 0.1
302 0.11
303 0.13
304 0.16
305 0.18
306 0.21
307 0.25
308 0.25
309 0.26
310 0.27
311 0.28
312 0.27
313 0.27
314 0.26
315 0.22
316 0.21
317 0.18
318 0.15
319 0.13
320 0.11
321 0.09
322 0.06
323 0.06
324 0.04
325 0.05
326 0.06
327 0.07
328 0.07
329 0.07
330 0.09
331 0.1
332 0.14
333 0.17
334 0.2
335 0.23
336 0.27
337 0.34
338 0.36
339 0.37
340 0.44
341 0.5
342 0.56
343 0.57