Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JRY2

Protein Details
Accession A0A1G4JRY2   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-105LDSVMRKRKLKMKKHKLRKRRKAQKAEKRKQSQGNBasic
NLS Segment(s)
PositionSequence
76-101RKRKLKMKKHKLRKRRKAQKAEKRKQ
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFGVLRRSVGLGMISRSMASTRLYSLSHNTWSQPMVIPTVICALNPQIPALSAVQCSPSQADKADENGMLLDSVMRKRKLKMKKHKLRKRRKAQKAEKRKQSQGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.13
5 0.12
6 0.12
7 0.11
8 0.12
9 0.14
10 0.15
11 0.16
12 0.2
13 0.22
14 0.24
15 0.24
16 0.23
17 0.22
18 0.22
19 0.22
20 0.19
21 0.16
22 0.14
23 0.13
24 0.12
25 0.11
26 0.13
27 0.12
28 0.1
29 0.09
30 0.09
31 0.11
32 0.12
33 0.11
34 0.08
35 0.09
36 0.1
37 0.1
38 0.1
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.1
48 0.12
49 0.11
50 0.14
51 0.15
52 0.13
53 0.13
54 0.12
55 0.11
56 0.09
57 0.08
58 0.06
59 0.07
60 0.12
61 0.18
62 0.21
63 0.23
64 0.28
65 0.37
66 0.46
67 0.55
68 0.62
69 0.68
70 0.76
71 0.85
72 0.91
73 0.94
74 0.95
75 0.95
76 0.95
77 0.95
78 0.95
79 0.95
80 0.96
81 0.96
82 0.96
83 0.96
84 0.95
85 0.93