Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4IM08

Protein Details
Accession A0A1G4IM08   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-119PTSLYKVLKKCKSKDDKKKLLKQILVTHydrophilic
NLS Segment(s)
PositionSequence
64-91KGKKAPGKKAPAKQGPVKQAPAKETPAK
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 10.833, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
Amino Acid Sequences MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCNTTFDDGVGYKKHTQCISEDEKYQKALYKGKKAPGKKAPAKQGPVKQAPAKETPAKQPTSLYKVLKKCKSKDDKKKLLKQILVTADGRLELPAQVSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.51
4 0.56
5 0.62
6 0.66
7 0.64
8 0.73
9 0.76
10 0.74
11 0.72
12 0.66
13 0.62
14 0.56
15 0.52
16 0.45
17 0.39
18 0.38
19 0.33
20 0.33
21 0.27
22 0.26
23 0.26
24 0.23
25 0.19
26 0.15
27 0.15
28 0.13
29 0.16
30 0.15
31 0.15
32 0.19
33 0.21
34 0.25
35 0.25
36 0.25
37 0.25
38 0.3
39 0.34
40 0.31
41 0.33
42 0.32
43 0.32
44 0.32
45 0.31
46 0.27
47 0.24
48 0.28
49 0.3
50 0.36
51 0.39
52 0.45
53 0.5
54 0.5
55 0.55
56 0.56
57 0.61
58 0.59
59 0.61
60 0.64
61 0.64
62 0.67
63 0.65
64 0.63
65 0.61
66 0.58
67 0.56
68 0.5
69 0.46
70 0.45
71 0.41
72 0.4
73 0.38
74 0.36
75 0.4
76 0.43
77 0.41
78 0.38
79 0.39
80 0.4
81 0.4
82 0.44
83 0.4
84 0.42
85 0.49
86 0.58
87 0.62
88 0.65
89 0.64
90 0.68
91 0.75
92 0.78
93 0.81
94 0.83
95 0.85
96 0.88
97 0.92
98 0.92
99 0.9
100 0.84
101 0.77
102 0.74
103 0.67
104 0.61
105 0.52
106 0.42
107 0.34
108 0.29
109 0.25
110 0.17
111 0.13
112 0.09
113 0.1