Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4KIS3

Protein Details
Accession A0A1G4KIS3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-170RELPDYKPSRRPNSRKPEPNFALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024274  APC9  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
Pfam View protein in Pfam  
PF12856  ANAPC9  
Amino Acid Sequences MPRKYPASPEQATFELPSLPPWRTPRIKILQNTPLRRGPLISSASNIFETPQPVPTPRVPGKDAESYDYSPFCDKKLLRESKQLQLQQSEIATHCLVFHNARQGDPILLRPDMNLWCCDSSDDEHEGLRNDDSAVPAVFDNAGYALSRELPDYKPSRRPNSRKPEPNFALIKHSLQSYWGSPELVNSLDNKQLQDQYHVLHQERQNMRAVKEELQSRQEVLPVGRNTEAKANILLQELERDESWTQQAGKCRPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.21
4 0.24
5 0.23
6 0.23
7 0.27
8 0.31
9 0.39
10 0.43
11 0.47
12 0.52
13 0.57
14 0.64
15 0.64
16 0.68
17 0.68
18 0.71
19 0.73
20 0.69
21 0.64
22 0.59
23 0.53
24 0.47
25 0.39
26 0.37
27 0.36
28 0.31
29 0.28
30 0.27
31 0.28
32 0.27
33 0.24
34 0.18
35 0.15
36 0.17
37 0.16
38 0.18
39 0.18
40 0.19
41 0.24
42 0.25
43 0.32
44 0.34
45 0.38
46 0.36
47 0.37
48 0.4
49 0.42
50 0.41
51 0.36
52 0.35
53 0.32
54 0.33
55 0.3
56 0.27
57 0.24
58 0.23
59 0.2
60 0.23
61 0.21
62 0.28
63 0.38
64 0.45
65 0.45
66 0.55
67 0.58
68 0.59
69 0.66
70 0.62
71 0.54
72 0.47
73 0.44
74 0.36
75 0.32
76 0.25
77 0.18
78 0.17
79 0.14
80 0.12
81 0.12
82 0.11
83 0.12
84 0.11
85 0.12
86 0.18
87 0.18
88 0.18
89 0.19
90 0.18
91 0.18
92 0.18
93 0.19
94 0.13
95 0.13
96 0.13
97 0.12
98 0.14
99 0.15
100 0.16
101 0.14
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.11
108 0.14
109 0.15
110 0.13
111 0.13
112 0.14
113 0.14
114 0.13
115 0.12
116 0.08
117 0.07
118 0.07
119 0.08
120 0.08
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.08
137 0.09
138 0.15
139 0.2
140 0.24
141 0.32
142 0.4
143 0.49
144 0.57
145 0.65
146 0.7
147 0.76
148 0.82
149 0.82
150 0.81
151 0.82
152 0.74
153 0.72
154 0.65
155 0.55
156 0.51
157 0.43
158 0.39
159 0.29
160 0.27
161 0.19
162 0.18
163 0.19
164 0.14
165 0.16
166 0.15
167 0.15
168 0.14
169 0.15
170 0.15
171 0.14
172 0.13
173 0.12
174 0.13
175 0.17
176 0.18
177 0.18
178 0.19
179 0.24
180 0.24
181 0.26
182 0.26
183 0.23
184 0.27
185 0.31
186 0.29
187 0.32
188 0.33
189 0.39
190 0.4
191 0.41
192 0.44
193 0.43
194 0.42
195 0.42
196 0.43
197 0.38
198 0.4
199 0.44
200 0.4
201 0.4
202 0.41
203 0.35
204 0.33
205 0.3
206 0.27
207 0.24
208 0.28
209 0.25
210 0.27
211 0.28
212 0.28
213 0.28
214 0.32
215 0.32
216 0.25
217 0.26
218 0.24
219 0.23
220 0.24
221 0.23
222 0.17
223 0.2
224 0.2
225 0.2
226 0.19
227 0.2
228 0.19
229 0.21
230 0.23
231 0.23
232 0.24
233 0.26
234 0.34
235 0.39