Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JD04

Protein Details
Accession A0A1G4JD04    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ANLSYRTVNWKKPHRRHKATRQLLSEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MDTKIQYLRTVAAENSTANLSYRTVNWKKPHRRHKATRQLLSEEWKRVTHANADKNLLTYFNVEAPPSIYPAKKYCDITGLKANYKAPGSGLRFYNSEVYSLVIKPMAPGIDQEYLKLRGDNVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.15
5 0.13
6 0.14
7 0.12
8 0.12
9 0.14
10 0.23
11 0.27
12 0.34
13 0.42
14 0.52
15 0.62
16 0.71
17 0.79
18 0.8
19 0.86
20 0.89
21 0.92
22 0.92
23 0.91
24 0.88
25 0.82
26 0.76
27 0.68
28 0.65
29 0.58
30 0.51
31 0.43
32 0.36
33 0.33
34 0.29
35 0.28
36 0.29
37 0.3
38 0.32
39 0.32
40 0.34
41 0.33
42 0.33
43 0.31
44 0.24
45 0.17
46 0.13
47 0.1
48 0.1
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.11
56 0.1
57 0.12
58 0.15
59 0.18
60 0.21
61 0.23
62 0.21
63 0.27
64 0.28
65 0.29
66 0.34
67 0.34
68 0.32
69 0.33
70 0.33
71 0.29
72 0.28
73 0.25
74 0.19
75 0.23
76 0.24
77 0.26
78 0.27
79 0.26
80 0.26
81 0.28
82 0.32
83 0.25
84 0.22
85 0.18
86 0.18
87 0.18
88 0.17
89 0.17
90 0.11
91 0.11
92 0.1
93 0.12
94 0.12
95 0.1
96 0.11
97 0.14
98 0.2
99 0.2
100 0.21
101 0.24
102 0.26
103 0.27
104 0.27
105 0.23
106 0.2