Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J988

Protein Details
Accession A0A1G4J988    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDPYSLKRDNRKKFFDKEKLKRRHATPSDRKYRIBasic
NLS Segment(s)
PositionSequence
10-25NRKKFFDKEKLKRRHA
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDPYSLKRDNRKKFFDKEKLKRRHATPSDRKYRILNKQEQSTTEIEEELSLEGNDYRYHEDLSMTYGQDEFDSQQVNRKLKEVLQKKVGDTDFGASERLTRKNLESMNVDQLNKVLGRNKFKSERTELSDALPAKSVPQIKKAPAQSASATTSMIPEELETEQSFLDDLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.86
5 0.88
6 0.88
7 0.9
8 0.88
9 0.82
10 0.82
11 0.8
12 0.81
13 0.81
14 0.81
15 0.83
16 0.78
17 0.75
18 0.72
19 0.72
20 0.71
21 0.7
22 0.68
23 0.64
24 0.68
25 0.69
26 0.63
27 0.58
28 0.49
29 0.41
30 0.32
31 0.26
32 0.18
33 0.16
34 0.14
35 0.1
36 0.09
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.11
44 0.11
45 0.12
46 0.12
47 0.12
48 0.12
49 0.15
50 0.15
51 0.12
52 0.12
53 0.11
54 0.11
55 0.1
56 0.11
57 0.08
58 0.07
59 0.09
60 0.08
61 0.15
62 0.21
63 0.23
64 0.23
65 0.23
66 0.23
67 0.25
68 0.35
69 0.34
70 0.33
71 0.39
72 0.4
73 0.38
74 0.43
75 0.39
76 0.31
77 0.25
78 0.22
79 0.15
80 0.14
81 0.15
82 0.08
83 0.11
84 0.14
85 0.15
86 0.15
87 0.16
88 0.17
89 0.22
90 0.23
91 0.23
92 0.24
93 0.24
94 0.31
95 0.33
96 0.31
97 0.26
98 0.25
99 0.23
100 0.2
101 0.18
102 0.17
103 0.19
104 0.27
105 0.31
106 0.37
107 0.43
108 0.46
109 0.52
110 0.53
111 0.53
112 0.52
113 0.53
114 0.47
115 0.42
116 0.44
117 0.38
118 0.32
119 0.27
120 0.2
121 0.17
122 0.21
123 0.25
124 0.22
125 0.29
126 0.33
127 0.35
128 0.43
129 0.46
130 0.48
131 0.44
132 0.45
133 0.4
134 0.39
135 0.38
136 0.31
137 0.28
138 0.21
139 0.2
140 0.16
141 0.14
142 0.1
143 0.07
144 0.09
145 0.1
146 0.13
147 0.13
148 0.13
149 0.13
150 0.13
151 0.13