Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EX42

Protein Details
Accession A0A0C4EX42   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
328-347MLKQQALKRRQERQAALKESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 12.666, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018612  NSRP1_N  
Gene Ontology GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF09745  NSRP1_N  
Amino Acid Sequences MIPIVPISSSKLSRQQRLAQEEATKLDSTIFEYDQVYDLMKLADSKAKSEKDQKGAERKVRAEDKLVQRERELEGQEFANKDEFVTPAYLQQQKELREAEEAEKLKAEKAPNKQAMTTFYQNILEEDSKRHEAAVKAVAAAAATTKKASSSISLGLSAALSDAKNSTENPGQSSQPQYDPEPEAVPSEAKLAVEIGKKLGRKVDIDDEGRIVDHRQLLTGGLNLGPPKLVGPQQPKKIGFALPIAERKAQEERERLENEASGKTKEEDDEEEGLTQAEKLKLSRERQSNLLQQQLIELENKKRKLEEESRTENMKKVAKRNDDSKIEMLKQQALKRRQERQAALKESEAQAPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.63
4 0.68
5 0.67
6 0.63
7 0.6
8 0.55
9 0.51
10 0.46
11 0.36
12 0.29
13 0.27
14 0.22
15 0.2
16 0.21
17 0.18
18 0.17
19 0.17
20 0.18
21 0.18
22 0.18
23 0.15
24 0.12
25 0.12
26 0.11
27 0.11
28 0.1
29 0.11
30 0.16
31 0.16
32 0.2
33 0.27
34 0.3
35 0.36
36 0.45
37 0.51
38 0.54
39 0.61
40 0.65
41 0.68
42 0.73
43 0.75
44 0.72
45 0.67
46 0.68
47 0.67
48 0.61
49 0.56
50 0.55
51 0.58
52 0.61
53 0.63
54 0.56
55 0.51
56 0.52
57 0.49
58 0.46
59 0.39
60 0.3
61 0.26
62 0.26
63 0.28
64 0.25
65 0.23
66 0.2
67 0.17
68 0.16
69 0.15
70 0.14
71 0.12
72 0.14
73 0.13
74 0.14
75 0.2
76 0.25
77 0.24
78 0.29
79 0.32
80 0.32
81 0.37
82 0.34
83 0.29
84 0.27
85 0.29
86 0.26
87 0.29
88 0.27
89 0.23
90 0.24
91 0.23
92 0.22
93 0.24
94 0.26
95 0.26
96 0.33
97 0.42
98 0.47
99 0.48
100 0.48
101 0.46
102 0.45
103 0.45
104 0.4
105 0.32
106 0.27
107 0.27
108 0.25
109 0.24
110 0.23
111 0.18
112 0.15
113 0.16
114 0.19
115 0.2
116 0.2
117 0.19
118 0.19
119 0.18
120 0.21
121 0.22
122 0.18
123 0.16
124 0.16
125 0.16
126 0.12
127 0.11
128 0.09
129 0.06
130 0.05
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.12
139 0.12
140 0.13
141 0.12
142 0.12
143 0.11
144 0.09
145 0.07
146 0.05
147 0.04
148 0.04
149 0.05
150 0.05
151 0.06
152 0.07
153 0.1
154 0.12
155 0.13
156 0.16
157 0.17
158 0.17
159 0.18
160 0.21
161 0.19
162 0.18
163 0.19
164 0.18
165 0.19
166 0.19
167 0.18
168 0.16
169 0.15
170 0.14
171 0.13
172 0.12
173 0.09
174 0.09
175 0.08
176 0.07
177 0.07
178 0.06
179 0.09
180 0.1
181 0.1
182 0.11
183 0.14
184 0.15
185 0.16
186 0.18
187 0.17
188 0.17
189 0.2
190 0.24
191 0.26
192 0.28
193 0.27
194 0.25
195 0.23
196 0.22
197 0.19
198 0.13
199 0.1
200 0.11
201 0.11
202 0.1
203 0.11
204 0.11
205 0.11
206 0.11
207 0.09
208 0.07
209 0.08
210 0.08
211 0.08
212 0.07
213 0.06
214 0.06
215 0.08
216 0.11
217 0.16
218 0.26
219 0.34
220 0.41
221 0.48
222 0.48
223 0.48
224 0.48
225 0.43
226 0.35
227 0.3
228 0.26
229 0.23
230 0.27
231 0.26
232 0.26
233 0.25
234 0.26
235 0.29
236 0.31
237 0.33
238 0.35
239 0.36
240 0.41
241 0.43
242 0.42
243 0.37
244 0.35
245 0.31
246 0.3
247 0.29
248 0.22
249 0.22
250 0.21
251 0.21
252 0.2
253 0.2
254 0.18
255 0.21
256 0.22
257 0.21
258 0.2
259 0.19
260 0.18
261 0.16
262 0.13
263 0.12
264 0.11
265 0.12
266 0.12
267 0.19
268 0.26
269 0.32
270 0.4
271 0.44
272 0.45
273 0.5
274 0.56
275 0.58
276 0.56
277 0.57
278 0.49
279 0.41
280 0.4
281 0.36
282 0.3
283 0.25
284 0.24
285 0.27
286 0.34
287 0.38
288 0.38
289 0.38
290 0.4
291 0.46
292 0.52
293 0.51
294 0.53
295 0.58
296 0.61
297 0.65
298 0.64
299 0.58
300 0.55
301 0.53
302 0.5
303 0.52
304 0.57
305 0.6
306 0.65
307 0.69
308 0.72
309 0.7
310 0.69
311 0.67
312 0.64
313 0.57
314 0.54
315 0.5
316 0.48
317 0.48
318 0.49
319 0.52
320 0.53
321 0.61
322 0.66
323 0.73
324 0.74
325 0.78
326 0.79
327 0.8
328 0.82
329 0.79
330 0.72
331 0.66
332 0.62
333 0.55
334 0.53