Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JCS6

Protein Details
Accession A0A1G4JCS6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
109-130WESHRESHRDQNKNKKHVRSDSBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, cyto 1.5, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSNEVGGRLSSRVLNMKFMKQAESTEELAKEEEETRSLIDSSEWKLSDRRKIASRLAPKIRNVGYAGVMAKNDQGGFVGRRKFGEAKDADDVKTTTPKRSADQDLDKLWESHRESHRDQNKNKKHVRSDSAENDAQPEPDSSHETPAKRFRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.37
4 0.4
5 0.4
6 0.4
7 0.34
8 0.34
9 0.31
10 0.32
11 0.3
12 0.27
13 0.27
14 0.24
15 0.23
16 0.22
17 0.18
18 0.16
19 0.14
20 0.12
21 0.12
22 0.12
23 0.13
24 0.12
25 0.11
26 0.1
27 0.12
28 0.14
29 0.18
30 0.18
31 0.18
32 0.22
33 0.27
34 0.34
35 0.35
36 0.37
37 0.38
38 0.42
39 0.47
40 0.51
41 0.55
42 0.55
43 0.6
44 0.59
45 0.55
46 0.57
47 0.51
48 0.45
49 0.38
50 0.3
51 0.22
52 0.2
53 0.19
54 0.13
55 0.12
56 0.1
57 0.09
58 0.09
59 0.08
60 0.06
61 0.05
62 0.06
63 0.08
64 0.12
65 0.14
66 0.14
67 0.15
68 0.18
69 0.2
70 0.19
71 0.25
72 0.22
73 0.23
74 0.28
75 0.28
76 0.26
77 0.25
78 0.25
79 0.18
80 0.25
81 0.23
82 0.21
83 0.24
84 0.26
85 0.27
86 0.33
87 0.37
88 0.36
89 0.42
90 0.43
91 0.4
92 0.41
93 0.4
94 0.34
95 0.3
96 0.3
97 0.26
98 0.3
99 0.35
100 0.38
101 0.41
102 0.5
103 0.59
104 0.61
105 0.67
106 0.7
107 0.73
108 0.77
109 0.82
110 0.81
111 0.8
112 0.8
113 0.79
114 0.74
115 0.73
116 0.7
117 0.68
118 0.61
119 0.52
120 0.47
121 0.41
122 0.35
123 0.27
124 0.22
125 0.16
126 0.17
127 0.24
128 0.21
129 0.28
130 0.33
131 0.34
132 0.4
133 0.49