Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4KCK9

Protein Details
Accession A0A1G4KCK9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
176-201REEEKLRRIVKKQAKKKKAEASEEDDBasic
NLS Segment(s)
PositionSequence
180-193KLRRIVKKQAKKKK
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYFYSSQPLETQAPYLLMVGKNKDENDLLIKYGFKEQNMIWFHTDKYSSAHIYLKQPAGEKALEDIPAEVLNDCLQLCKAKSIQGNKMAQCSIICTPWTNLRKSGYMKAGEVSFKSKNRVRRLNCYARDNAVLNRIEKTRLEVEDNVGSFLHTAKKSKNGEYLLEYLEQNSDSLREEEKLRRIVKKQAKKKKAEASEEDDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.17
5 0.17
6 0.2
7 0.22
8 0.24
9 0.27
10 0.27
11 0.29
12 0.26
13 0.25
14 0.27
15 0.25
16 0.23
17 0.2
18 0.2
19 0.19
20 0.27
21 0.27
22 0.21
23 0.24
24 0.22
25 0.3
26 0.32
27 0.34
28 0.28
29 0.28
30 0.28
31 0.28
32 0.29
33 0.21
34 0.21
35 0.22
36 0.21
37 0.22
38 0.24
39 0.24
40 0.27
41 0.32
42 0.31
43 0.29
44 0.29
45 0.28
46 0.27
47 0.24
48 0.2
49 0.18
50 0.17
51 0.16
52 0.14
53 0.13
54 0.1
55 0.1
56 0.1
57 0.08
58 0.07
59 0.06
60 0.07
61 0.06
62 0.06
63 0.06
64 0.08
65 0.08
66 0.11
67 0.11
68 0.15
69 0.2
70 0.26
71 0.31
72 0.37
73 0.42
74 0.39
75 0.41
76 0.37
77 0.32
78 0.27
79 0.24
80 0.17
81 0.13
82 0.12
83 0.11
84 0.12
85 0.2
86 0.23
87 0.22
88 0.23
89 0.24
90 0.27
91 0.29
92 0.33
93 0.29
94 0.27
95 0.26
96 0.25
97 0.24
98 0.21
99 0.19
100 0.19
101 0.19
102 0.19
103 0.25
104 0.27
105 0.34
106 0.42
107 0.51
108 0.52
109 0.57
110 0.65
111 0.69
112 0.71
113 0.68
114 0.62
115 0.55
116 0.53
117 0.44
118 0.36
119 0.32
120 0.29
121 0.24
122 0.25
123 0.23
124 0.22
125 0.21
126 0.24
127 0.22
128 0.21
129 0.25
130 0.23
131 0.25
132 0.27
133 0.27
134 0.24
135 0.19
136 0.17
137 0.14
138 0.14
139 0.17
140 0.14
141 0.17
142 0.19
143 0.28
144 0.32
145 0.36
146 0.42
147 0.39
148 0.4
149 0.42
150 0.42
151 0.35
152 0.33
153 0.29
154 0.22
155 0.21
156 0.18
157 0.13
158 0.11
159 0.1
160 0.1
161 0.12
162 0.13
163 0.14
164 0.19
165 0.26
166 0.33
167 0.4
168 0.43
169 0.49
170 0.51
171 0.6
172 0.66
173 0.7
174 0.74
175 0.77
176 0.82
177 0.84
178 0.89
179 0.89
180 0.88
181 0.86
182 0.83
183 0.79