Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F8T8

Protein Details
Accession A0A0C4F8T8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-42CDGNPMPKVKRVKKEKDPNAPKRPLSHydrophilic
NLS Segment(s)
PositionSequence
24-38KVKRVKKEKDPNAPK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDTTASSKRAPKLDCDGNPMPKVKRVKKEKDPNAPKRPLSAYMYFSQDWRERIKTENPDVSFGEIGRLLGLKWKALAEEEKKPYEDMASRDKKRHEAEKAEYERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.54
4 0.53
5 0.54
6 0.54
7 0.56
8 0.55
9 0.48
10 0.45
11 0.53
12 0.53
13 0.57
14 0.6
15 0.67
16 0.73
17 0.82
18 0.85
19 0.87
20 0.89
21 0.9
22 0.9
23 0.86
24 0.76
25 0.69
26 0.62
27 0.55
28 0.49
29 0.42
30 0.36
31 0.31
32 0.34
33 0.3
34 0.27
35 0.27
36 0.24
37 0.23
38 0.23
39 0.23
40 0.2
41 0.23
42 0.3
43 0.31
44 0.34
45 0.38
46 0.35
47 0.36
48 0.35
49 0.33
50 0.27
51 0.21
52 0.17
53 0.11
54 0.1
55 0.07
56 0.07
57 0.05
58 0.1
59 0.11
60 0.1
61 0.11
62 0.11
63 0.11
64 0.13
65 0.2
66 0.2
67 0.28
68 0.33
69 0.35
70 0.36
71 0.36
72 0.34
73 0.32
74 0.31
75 0.27
76 0.32
77 0.4
78 0.44
79 0.49
80 0.53
81 0.58
82 0.61
83 0.66
84 0.64
85 0.63
86 0.66
87 0.71