Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4K8U7

Protein Details
Accession A0A1G4K8U7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-43LLWKIPWRLSRPQKQRQRHRLQQVDNVLKHydrophilic
100-131TFFNKRSKGYRKGIHKLPKWTKMSQRRNPEFFHydrophilic
NLS Segment(s)
PositionSequence
105-118RSKGYRKGIHKLPK
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKSSNTLLGGLLWKIPWRLSRPQKQRQRHRLQQVDNVLKTVNLGLHIMRNESKGLAFQDAVAAPKLLKPNVKQLRVLGKPSFFPSEKQMSYKDKYTFFNKRSKGYRKGIHKLPKWTKMSQRRNPEFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.14
5 0.14
6 0.16
7 0.2
8 0.24
9 0.33
10 0.43
11 0.53
12 0.61
13 0.71
14 0.78
15 0.84
16 0.9
17 0.9
18 0.91
19 0.9
20 0.9
21 0.89
22 0.84
23 0.82
24 0.8
25 0.77
26 0.66
27 0.57
28 0.46
29 0.37
30 0.31
31 0.24
32 0.14
33 0.07
34 0.08
35 0.07
36 0.1
37 0.1
38 0.12
39 0.12
40 0.12
41 0.12
42 0.12
43 0.11
44 0.1
45 0.11
46 0.1
47 0.09
48 0.08
49 0.09
50 0.09
51 0.1
52 0.09
53 0.08
54 0.06
55 0.09
56 0.11
57 0.11
58 0.14
59 0.15
60 0.25
61 0.33
62 0.36
63 0.34
64 0.36
65 0.44
66 0.44
67 0.47
68 0.39
69 0.32
70 0.32
71 0.33
72 0.35
73 0.26
74 0.25
75 0.26
76 0.31
77 0.31
78 0.32
79 0.34
80 0.36
81 0.39
82 0.43
83 0.42
84 0.39
85 0.42
86 0.48
87 0.52
88 0.5
89 0.56
90 0.54
91 0.58
92 0.64
93 0.68
94 0.69
95 0.69
96 0.73
97 0.73
98 0.78
99 0.8
100 0.8
101 0.78
102 0.8
103 0.81
104 0.82
105 0.78
106 0.77
107 0.78
108 0.78
109 0.82
110 0.81
111 0.82