Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JQ44

Protein Details
Accession A0A1G4JQ44    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
127-155LSPASSRKSKSNKNEKKGLWKKIKSVFSSHydrophilic
NLS Segment(s)
PositionSequence
96-150KAKNSEGLKTKRSRPDPPKTVVIGRGGAGNILSPASSRKSKSNKNEKKGLWKKIK
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MAQEYKVSTGRGGAGNVAVTSDKPVPKMVPQGSQTPSILQPVFSTGRGGAGNMRKNVDSKMTRKAQDVEYSENEDLITEGNVDAIDSRGSRGGSLKAKNSEGLKTKRSRPDPPKTVVIGRGGAGNILSPASSRKSKSNKNEKKGLWKKIKSVFSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.11
6 0.09
7 0.12
8 0.16
9 0.17
10 0.17
11 0.2
12 0.21
13 0.24
14 0.33
15 0.32
16 0.34
17 0.35
18 0.4
19 0.41
20 0.42
21 0.39
22 0.32
23 0.3
24 0.27
25 0.25
26 0.19
27 0.17
28 0.18
29 0.19
30 0.17
31 0.17
32 0.12
33 0.15
34 0.14
35 0.14
36 0.15
37 0.2
38 0.25
39 0.26
40 0.27
41 0.25
42 0.27
43 0.27
44 0.3
45 0.29
46 0.27
47 0.34
48 0.38
49 0.39
50 0.41
51 0.43
52 0.38
53 0.38
54 0.38
55 0.34
56 0.3
57 0.32
58 0.3
59 0.27
60 0.23
61 0.17
62 0.14
63 0.1
64 0.08
65 0.04
66 0.03
67 0.04
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.07
78 0.09
79 0.13
80 0.19
81 0.22
82 0.26
83 0.28
84 0.28
85 0.31
86 0.32
87 0.32
88 0.34
89 0.36
90 0.39
91 0.41
92 0.49
93 0.55
94 0.59
95 0.64
96 0.66
97 0.72
98 0.72
99 0.71
100 0.69
101 0.64
102 0.61
103 0.53
104 0.47
105 0.37
106 0.3
107 0.26
108 0.2
109 0.17
110 0.13
111 0.1
112 0.08
113 0.07
114 0.06
115 0.05
116 0.08
117 0.13
118 0.17
119 0.2
120 0.29
121 0.38
122 0.48
123 0.59
124 0.68
125 0.74
126 0.77
127 0.85
128 0.82
129 0.84
130 0.84
131 0.84
132 0.83
133 0.79
134 0.79
135 0.79
136 0.81