Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4ITN7

Protein Details
Accession A0A1G4ITN7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
274-295EKEAEFRKRRKLAKKNGDGEKLBasic
476-503QQQQQYPQQHPQQRQQQHPQQHQQHQPQHydrophilic
NLS Segment(s)
PositionSequence
280-291RKRRKLAKKNGD
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR040309  Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0000493  P:box H/ACA snoRNP assembly  
GO:0001522  P:pseudouridine synthesis  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MTETFEKALKNSKDTAPVSLQNDVDLADIENLSSDEGEVLPSKASNEKADEERADVRSESNSSLAKPDEDAGVSKDPVADTLSDKDPSSDESSESESDDDESVSLGGDAADIGASADEDEDATQEPIRSKNESAEEPLPSLPDGFEVGPETPIHEMGVLSKAFDFNLIIQATTSAEQRVLKEGSVLCLEDRTLLGPLCEVFGPLQSPFYRVSFPKDQKEAFDRLKALTGQKVFFVRPEAHWLDTFDLKRTKGTDASNGFDEELPEDEQEFSDDEKEAEFRKRRKLAKKNGDGEKLETMAISKKPQKLAVARSAKNLPGSAGIAYRSRNARQSEKKDNHQTTGGYSASQPQVPLQSVAQAPPAQLGYGYMPTYANPYPQNSYPTPQANVIYPQQAQFSGYPGASGAPYSPQYAANYANQAQLYNANYGQQHSQYPPYGHFAFNPSTYNPVSQQPLYQNQNAAQVAELQRILMQQQQQQQQQYPQQHPQQRQQQHPQQHQQHQPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.46
4 0.49
5 0.48
6 0.47
7 0.43
8 0.34
9 0.33
10 0.27
11 0.21
12 0.15
13 0.13
14 0.1
15 0.1
16 0.09
17 0.09
18 0.09
19 0.09
20 0.08
21 0.07
22 0.06
23 0.06
24 0.08
25 0.09
26 0.1
27 0.1
28 0.1
29 0.12
30 0.16
31 0.19
32 0.21
33 0.24
34 0.28
35 0.31
36 0.36
37 0.36
38 0.35
39 0.37
40 0.35
41 0.34
42 0.29
43 0.27
44 0.25
45 0.26
46 0.23
47 0.22
48 0.22
49 0.2
50 0.23
51 0.23
52 0.21
53 0.2
54 0.2
55 0.18
56 0.17
57 0.18
58 0.18
59 0.2
60 0.19
61 0.18
62 0.18
63 0.16
64 0.16
65 0.16
66 0.13
67 0.13
68 0.17
69 0.2
70 0.2
71 0.2
72 0.2
73 0.2
74 0.22
75 0.25
76 0.22
77 0.2
78 0.2
79 0.24
80 0.24
81 0.24
82 0.2
83 0.15
84 0.16
85 0.15
86 0.12
87 0.09
88 0.08
89 0.07
90 0.07
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.12
113 0.15
114 0.18
115 0.21
116 0.21
117 0.25
118 0.29
119 0.29
120 0.32
121 0.32
122 0.3
123 0.29
124 0.28
125 0.23
126 0.19
127 0.17
128 0.12
129 0.09
130 0.1
131 0.08
132 0.08
133 0.09
134 0.1
135 0.1
136 0.1
137 0.11
138 0.1
139 0.1
140 0.09
141 0.08
142 0.07
143 0.07
144 0.11
145 0.1
146 0.1
147 0.1
148 0.1
149 0.1
150 0.1
151 0.09
152 0.06
153 0.12
154 0.11
155 0.11
156 0.1
157 0.11
158 0.11
159 0.12
160 0.12
161 0.07
162 0.09
163 0.1
164 0.11
165 0.15
166 0.15
167 0.14
168 0.16
169 0.16
170 0.16
171 0.16
172 0.16
173 0.11
174 0.11
175 0.11
176 0.09
177 0.08
178 0.07
179 0.08
180 0.07
181 0.07
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.05
188 0.06
189 0.07
190 0.07
191 0.1
192 0.09
193 0.11
194 0.12
195 0.13
196 0.16
197 0.15
198 0.22
199 0.29
200 0.33
201 0.38
202 0.41
203 0.4
204 0.4
205 0.44
206 0.44
207 0.37
208 0.35
209 0.3
210 0.26
211 0.28
212 0.27
213 0.23
214 0.21
215 0.21
216 0.18
217 0.19
218 0.2
219 0.18
220 0.17
221 0.18
222 0.15
223 0.14
224 0.2
225 0.2
226 0.2
227 0.2
228 0.21
229 0.19
230 0.22
231 0.22
232 0.19
233 0.2
234 0.19
235 0.2
236 0.2
237 0.2
238 0.2
239 0.21
240 0.25
241 0.24
242 0.26
243 0.25
244 0.24
245 0.23
246 0.19
247 0.17
248 0.11
249 0.1
250 0.09
251 0.08
252 0.08
253 0.07
254 0.07
255 0.08
256 0.08
257 0.06
258 0.07
259 0.07
260 0.07
261 0.07
262 0.08
263 0.09
264 0.16
265 0.23
266 0.26
267 0.35
268 0.43
269 0.51
270 0.61
271 0.69
272 0.73
273 0.77
274 0.83
275 0.82
276 0.82
277 0.79
278 0.7
279 0.62
280 0.53
281 0.42
282 0.32
283 0.24
284 0.17
285 0.15
286 0.15
287 0.17
288 0.22
289 0.25
290 0.27
291 0.29
292 0.34
293 0.36
294 0.4
295 0.45
296 0.48
297 0.45
298 0.47
299 0.47
300 0.44
301 0.39
302 0.34
303 0.24
304 0.17
305 0.17
306 0.13
307 0.12
308 0.12
309 0.12
310 0.13
311 0.16
312 0.18
313 0.2
314 0.25
315 0.29
316 0.37
317 0.45
318 0.52
319 0.6
320 0.62
321 0.7
322 0.74
323 0.73
324 0.66
325 0.59
326 0.51
327 0.42
328 0.41
329 0.31
330 0.21
331 0.19
332 0.21
333 0.2
334 0.19
335 0.18
336 0.14
337 0.17
338 0.17
339 0.18
340 0.13
341 0.16
342 0.16
343 0.16
344 0.18
345 0.16
346 0.15
347 0.15
348 0.15
349 0.11
350 0.1
351 0.1
352 0.09
353 0.1
354 0.11
355 0.1
356 0.1
357 0.1
358 0.15
359 0.15
360 0.17
361 0.17
362 0.2
363 0.23
364 0.26
365 0.32
366 0.29
367 0.32
368 0.34
369 0.36
370 0.35
371 0.33
372 0.32
373 0.28
374 0.3
375 0.29
376 0.27
377 0.24
378 0.23
379 0.22
380 0.21
381 0.21
382 0.17
383 0.18
384 0.16
385 0.15
386 0.14
387 0.13
388 0.13
389 0.11
390 0.11
391 0.08
392 0.09
393 0.11
394 0.13
395 0.14
396 0.15
397 0.17
398 0.19
399 0.21
400 0.2
401 0.24
402 0.24
403 0.26
404 0.24
405 0.23
406 0.21
407 0.22
408 0.22
409 0.2
410 0.19
411 0.18
412 0.19
413 0.21
414 0.23
415 0.21
416 0.23
417 0.23
418 0.28
419 0.29
420 0.31
421 0.31
422 0.34
423 0.34
424 0.31
425 0.3
426 0.3
427 0.29
428 0.29
429 0.29
430 0.24
431 0.27
432 0.27
433 0.28
434 0.26
435 0.27
436 0.3
437 0.28
438 0.33
439 0.34
440 0.42
441 0.45
442 0.46
443 0.44
444 0.41
445 0.48
446 0.43
447 0.36
448 0.28
449 0.29
450 0.28
451 0.28
452 0.25
453 0.18
454 0.19
455 0.19
456 0.2
457 0.19
458 0.22
459 0.25
460 0.33
461 0.41
462 0.46
463 0.51
464 0.55
465 0.58
466 0.61
467 0.64
468 0.63
469 0.65
470 0.68
471 0.71
472 0.74
473 0.75
474 0.78
475 0.78
476 0.8
477 0.82
478 0.82
479 0.84
480 0.87
481 0.88
482 0.88
483 0.88