Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EY66

Protein Details
Accession A0A0C4EY66    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-107STSNNMRKSHNPRQWKKLMRVAHydrophilic
NLS Segment(s)
PositionSequence
81-84GKKR
Subcellular Location(s) nucl 16.5, mito_nucl 13.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MSKIKLTKHLVKEHIKLWQECAKSQPHGASEELRALLRKAQESQKSCQKIMKQHELEAHVQGWNPWTVMKFMFPAKNGDKGKKRSSTSNNMRKSHNPRQWKKLMRVADTLDQAYNNMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.53
4 0.51
5 0.49
6 0.43
7 0.4
8 0.41
9 0.38
10 0.34
11 0.37
12 0.34
13 0.29
14 0.29
15 0.3
16 0.28
17 0.24
18 0.24
19 0.22
20 0.19
21 0.17
22 0.15
23 0.17
24 0.17
25 0.17
26 0.19
27 0.25
28 0.33
29 0.36
30 0.41
31 0.46
32 0.48
33 0.47
34 0.47
35 0.44
36 0.45
37 0.49
38 0.54
39 0.46
40 0.45
41 0.48
42 0.46
43 0.43
44 0.36
45 0.29
46 0.19
47 0.17
48 0.15
49 0.12
50 0.09
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.09
57 0.09
58 0.13
59 0.15
60 0.16
61 0.21
62 0.22
63 0.31
64 0.33
65 0.4
66 0.45
67 0.49
68 0.56
69 0.58
70 0.58
71 0.59
72 0.64
73 0.67
74 0.7
75 0.73
76 0.74
77 0.7
78 0.72
79 0.72
80 0.73
81 0.73
82 0.71
83 0.72
84 0.71
85 0.78
86 0.83
87 0.83
88 0.81
89 0.78
90 0.77
91 0.71
92 0.69
93 0.64
94 0.6
95 0.55
96 0.48
97 0.41
98 0.33