Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4J5K2

Protein Details
Accession A0A1G4J5K2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-43GYQVANRKDLKRRNEKREVTLITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018468  SFR1/Mei5  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF10376  Mei5  
Amino Acid Sequences MVTKLAVSKNEYRSKDGFKDGYQVANRKDLKRRNEKREVTLITDINQLKRKILHLKSGIKILNSYEKETEVENLAFKWRRICQAGMAYMLNSTLIKIDKMGGYEELVRREIEAEKRKIEYQFSDNLEQDIENLLESEEFKMLSTDEQQEYRDKMDAKRQEVEDLQQKELQKLEEKLGKTRETQMTMQELARRLNVDYKMVFEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.58
4 0.52
5 0.45
6 0.49
7 0.44
8 0.47
9 0.45
10 0.46
11 0.41
12 0.47
13 0.51
14 0.5
15 0.58
16 0.59
17 0.63
18 0.68
19 0.76
20 0.77
21 0.82
22 0.82
23 0.79
24 0.8
25 0.74
26 0.68
27 0.63
28 0.54
29 0.45
30 0.46
31 0.41
32 0.36
33 0.39
34 0.34
35 0.3
36 0.31
37 0.35
38 0.37
39 0.39
40 0.42
41 0.44
42 0.51
43 0.5
44 0.55
45 0.51
46 0.42
47 0.4
48 0.33
49 0.34
50 0.29
51 0.3
52 0.24
53 0.23
54 0.24
55 0.23
56 0.22
57 0.16
58 0.14
59 0.12
60 0.12
61 0.16
62 0.17
63 0.17
64 0.21
65 0.21
66 0.24
67 0.27
68 0.27
69 0.25
70 0.28
71 0.29
72 0.26
73 0.24
74 0.19
75 0.16
76 0.15
77 0.11
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.08
87 0.09
88 0.07
89 0.08
90 0.11
91 0.12
92 0.13
93 0.13
94 0.12
95 0.12
96 0.13
97 0.15
98 0.2
99 0.26
100 0.28
101 0.29
102 0.31
103 0.33
104 0.33
105 0.33
106 0.28
107 0.24
108 0.27
109 0.29
110 0.3
111 0.28
112 0.27
113 0.25
114 0.21
115 0.18
116 0.13
117 0.1
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.1
131 0.14
132 0.15
133 0.16
134 0.18
135 0.21
136 0.22
137 0.23
138 0.24
139 0.23
140 0.24
141 0.32
142 0.38
143 0.39
144 0.44
145 0.43
146 0.44
147 0.42
148 0.45
149 0.44
150 0.4
151 0.38
152 0.36
153 0.36
154 0.33
155 0.34
156 0.31
157 0.28
158 0.27
159 0.31
160 0.34
161 0.35
162 0.4
163 0.44
164 0.43
165 0.4
166 0.47
167 0.47
168 0.45
169 0.45
170 0.44
171 0.43
172 0.42
173 0.42
174 0.38
175 0.35
176 0.32
177 0.32
178 0.29
179 0.25
180 0.3
181 0.3
182 0.3
183 0.28