Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4KHJ3

Protein Details
Accession A0A1G4KHJ3   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-138SPGWPAAPAKSKKKKKNKIPCSYCHETGHydrophilic
NLS Segment(s)
PositionSequence
117-128APAKSKKKKKNK
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MEDTVQISQAMDALAKTILARRLQQQKDGESDPQQRWRDLKGALDPILALQRDEAGNTVEMDSVPLTSSPSPRLELLERNGQKFALVPVKRVSNGYSQASRSGATATTSPSPGWPAAPAKSKKKKKNKIPCSYCHETGHTRAHCENRLLNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.11
5 0.15
6 0.18
7 0.21
8 0.28
9 0.38
10 0.41
11 0.48
12 0.48
13 0.47
14 0.5
15 0.5
16 0.47
17 0.44
18 0.49
19 0.46
20 0.51
21 0.5
22 0.47
23 0.46
24 0.45
25 0.42
26 0.36
27 0.35
28 0.31
29 0.33
30 0.3
31 0.28
32 0.25
33 0.21
34 0.23
35 0.19
36 0.14
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.07
43 0.08
44 0.08
45 0.09
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.1
57 0.12
58 0.13
59 0.13
60 0.15
61 0.15
62 0.18
63 0.19
64 0.26
65 0.27
66 0.27
67 0.27
68 0.24
69 0.22
70 0.19
71 0.19
72 0.19
73 0.18
74 0.19
75 0.21
76 0.23
77 0.24
78 0.24
79 0.23
80 0.19
81 0.23
82 0.24
83 0.25
84 0.24
85 0.25
86 0.25
87 0.23
88 0.18
89 0.15
90 0.12
91 0.11
92 0.11
93 0.12
94 0.13
95 0.14
96 0.13
97 0.13
98 0.15
99 0.14
100 0.14
101 0.14
102 0.16
103 0.2
104 0.29
105 0.35
106 0.43
107 0.54
108 0.64
109 0.71
110 0.79
111 0.85
112 0.87
113 0.92
114 0.92
115 0.93
116 0.92
117 0.9
118 0.88
119 0.85
120 0.79
121 0.72
122 0.66
123 0.6
124 0.58
125 0.59
126 0.52
127 0.49
128 0.5
129 0.53
130 0.52
131 0.52
132 0.52