Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FBD1

Protein Details
Accession A0A0C4FBD1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-151SNERDPKKPYKIPKIDRTKPAAPGSKPKPYERKPKKGENKWKETFRMABasic
NLS Segment(s)
PositionSequence
92-145KVLEKNKQPAKESNERDPKKPYKIPKIDRTKPAAPGSKPKPYERKPKKGENKWK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVDTRSGKDHSANPPPTKKVLNKAQEDAIAIFKATKAAYLNAKNYDEMDLLKSYLEQVISSFKVVQKFLPWKEILTKHSDGWNPYTERKHIKVLEKNKQPAKESNERDPKKPYKIPKIDRTKPAAPGSKPKPYERKPKKGENKWKETFRMARVLMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.63
4 0.64
5 0.61
6 0.6
7 0.62
8 0.63
9 0.61
10 0.61
11 0.59
12 0.53
13 0.49
14 0.41
15 0.33
16 0.24
17 0.18
18 0.15
19 0.12
20 0.13
21 0.1
22 0.11
23 0.1
24 0.13
25 0.2
26 0.25
27 0.29
28 0.31
29 0.33
30 0.31
31 0.3
32 0.29
33 0.23
34 0.19
35 0.17
36 0.13
37 0.12
38 0.12
39 0.11
40 0.09
41 0.1
42 0.09
43 0.06
44 0.07
45 0.1
46 0.1
47 0.11
48 0.12
49 0.13
50 0.16
51 0.16
52 0.16
53 0.19
54 0.25
55 0.25
56 0.29
57 0.27
58 0.25
59 0.31
60 0.34
61 0.31
62 0.3
63 0.31
64 0.27
65 0.31
66 0.32
67 0.27
68 0.26
69 0.28
70 0.24
71 0.27
72 0.28
73 0.27
74 0.3
75 0.31
76 0.35
77 0.35
78 0.41
79 0.45
80 0.52
81 0.59
82 0.62
83 0.67
84 0.65
85 0.64
86 0.6
87 0.58
88 0.57
89 0.57
90 0.54
91 0.56
92 0.62
93 0.61
94 0.61
95 0.63
96 0.62
97 0.61
98 0.63
99 0.62
100 0.62
101 0.71
102 0.76
103 0.77
104 0.81
105 0.81
106 0.81
107 0.8
108 0.73
109 0.69
110 0.68
111 0.65
112 0.58
113 0.6
114 0.59
115 0.6
116 0.6
117 0.61
118 0.65
119 0.65
120 0.74
121 0.74
122 0.79
123 0.77
124 0.84
125 0.87
126 0.88
127 0.91
128 0.9
129 0.9
130 0.88
131 0.87
132 0.81
133 0.79
134 0.75
135 0.68
136 0.66
137 0.57
138 0.5
139 0.47
140 0.46
141 0.38
142 0.34
143 0.3