Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4IU89

Protein Details
Accession A0A1G4IU89    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAKHAVVLHydrophilic
NLS Segment(s)
PositionSequence
11-37AKAAAAMAGGKKSKKKWSKKSHKDKAK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAKHAVVLDQEKYDRIMKEVPTYRYVSVSVLVDRLKIGGSLARIALRQLENDGIISPVSKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.9
22 0.88
23 0.84
24 0.76
25 0.65
26 0.59
27 0.53
28 0.51
29 0.42
30 0.33
31 0.25
32 0.22
33 0.24
34 0.22
35 0.18
36 0.14
37 0.16
38 0.16
39 0.22
40 0.27
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.14
67 0.13
68 0.13
69 0.14
70 0.14
71 0.14
72 0.14
73 0.14
74 0.1
75 0.1
76 0.09
77 0.09
78 0.14
79 0.2
80 0.2
81 0.23
82 0.29
83 0.35
84 0.39
85 0.46
86 0.47
87 0.46
88 0.49