Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F800

Protein Details
Accession A0A0C4F800   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
127-150NPQSNKRKTQSGTTQPRRSKRSKNHydrophilic
NLS Segment(s)
PositionSequence
144-149RSKRSK
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
Pfam View protein in Pfam  
PF01878  EVE  
Amino Acid Sequences MRKGDRVLFYHSNCKFPGIAGIAEIDKEGYPDFTAFDPSHPYHDPKSMESKPTWFMVDVKFVSRLPNFVPLKLLQNLISGKPVPLEAFEVVRNLGVKGGWLSTEKVNLASKPTKISSDQSDGTNLDNPQSNKRKTQSGTTQPRRSKRSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.36
3 0.29
4 0.31
5 0.23
6 0.21
7 0.17
8 0.19
9 0.16
10 0.16
11 0.16
12 0.11
13 0.08
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.1
20 0.09
21 0.14
22 0.13
23 0.14
24 0.19
25 0.19
26 0.23
27 0.24
28 0.27
29 0.25
30 0.31
31 0.32
32 0.29
33 0.37
34 0.35
35 0.37
36 0.35
37 0.35
38 0.32
39 0.31
40 0.29
41 0.21
42 0.2
43 0.18
44 0.22
45 0.19
46 0.18
47 0.18
48 0.18
49 0.2
50 0.18
51 0.18
52 0.14
53 0.23
54 0.22
55 0.21
56 0.23
57 0.2
58 0.23
59 0.23
60 0.23
61 0.14
62 0.16
63 0.17
64 0.15
65 0.16
66 0.12
67 0.11
68 0.11
69 0.11
70 0.08
71 0.07
72 0.09
73 0.08
74 0.09
75 0.09
76 0.1
77 0.09
78 0.1
79 0.1
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.09
89 0.1
90 0.12
91 0.12
92 0.14
93 0.16
94 0.16
95 0.21
96 0.23
97 0.23
98 0.26
99 0.27
100 0.27
101 0.28
102 0.31
103 0.31
104 0.34
105 0.34
106 0.31
107 0.32
108 0.3
109 0.29
110 0.3
111 0.24
112 0.2
113 0.24
114 0.25
115 0.32
116 0.41
117 0.43
118 0.46
119 0.5
120 0.57
121 0.54
122 0.62
123 0.62
124 0.64
125 0.72
126 0.74
127 0.81
128 0.81
129 0.87
130 0.86