Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EZD5

Protein Details
Accession A0A0C4EZD5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-74LYEEEDTKKKKKKKKKQTKKKRRRRRTLKKQKTGKNRLSVHSBasic
NLS Segment(s)
PositionSequence
40-79KKKKKKKKKQTKKKRRRRRTLKKQKTGKNRLSVHSQKLKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MKGPYKLEELDGTKLARRYAANQVKKFYPRGELYEEEDTKKKKKKKKKQTKKKRRRRRTLKKQKTGKNRLSVHSQKLKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.25
4 0.23
5 0.24
6 0.32
7 0.41
8 0.46
9 0.48
10 0.51
11 0.53
12 0.55
13 0.54
14 0.45
15 0.41
16 0.35
17 0.35
18 0.36
19 0.33
20 0.34
21 0.38
22 0.37
23 0.32
24 0.34
25 0.33
26 0.34
27 0.4
28 0.43
29 0.46
30 0.56
31 0.65
32 0.73
33 0.82
34 0.87
35 0.91
36 0.95
37 0.97
38 0.97
39 0.97
40 0.97
41 0.97
42 0.97
43 0.97
44 0.97
45 0.97
46 0.97
47 0.97
48 0.96
49 0.95
50 0.94
51 0.94
52 0.93
53 0.9
54 0.88
55 0.83
56 0.77
57 0.77
58 0.75
59 0.74
60 0.73