Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EW38

Protein Details
Accession A0A0C4EW38    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33GAPSRDPIIKRKKPASKPAPKCATPHydrophilic
NLS Segment(s)
PositionSequence
17-43IKRKKPASKPAPKCATPPPSSRAERRK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MFSSTCPIGAPSRDPIIKRKKPASKPAPKCATPPPSSRAERRKGMIITTPPALPPSPLRSQRRKGLILAANELPPELKNLPPSPPPPASRRNGMVLTANDLPQEVKDLKFAGGSVTKPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.49
4 0.54
5 0.59
6 0.64
7 0.68
8 0.73
9 0.82
10 0.84
11 0.84
12 0.85
13 0.87
14 0.85
15 0.76
16 0.71
17 0.7
18 0.67
19 0.61
20 0.56
21 0.5
22 0.5
23 0.53
24 0.57
25 0.57
26 0.55
27 0.55
28 0.53
29 0.55
30 0.47
31 0.45
32 0.42
33 0.36
34 0.31
35 0.28
36 0.26
37 0.19
38 0.2
39 0.18
40 0.13
41 0.13
42 0.16
43 0.21
44 0.29
45 0.36
46 0.42
47 0.47
48 0.52
49 0.56
50 0.52
51 0.46
52 0.46
53 0.44
54 0.38
55 0.37
56 0.31
57 0.26
58 0.24
59 0.23
60 0.15
61 0.1
62 0.12
63 0.1
64 0.11
65 0.15
66 0.17
67 0.2
68 0.24
69 0.27
70 0.3
71 0.34
72 0.36
73 0.37
74 0.44
75 0.45
76 0.46
77 0.47
78 0.45
79 0.41
80 0.39
81 0.39
82 0.32
83 0.33
84 0.29
85 0.26
86 0.21
87 0.2
88 0.19
89 0.13
90 0.18
91 0.14
92 0.13
93 0.15
94 0.17
95 0.17
96 0.17
97 0.17
98 0.17
99 0.19