Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JDW8

Protein Details
Accession A0A1G4JDW8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
62-81RKGRVYVYCKSNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MQNSLLSSLARLNPRFINRTITPGLPVLFRPISSTLSSFLVRGFKVRTAVKKFCSDCYMVRRKGRVYVYCKSNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.38
4 0.4
5 0.35
6 0.4
7 0.39
8 0.33
9 0.3
10 0.27
11 0.26
12 0.19
13 0.19
14 0.18
15 0.15
16 0.15
17 0.15
18 0.15
19 0.17
20 0.17
21 0.17
22 0.14
23 0.16
24 0.16
25 0.14
26 0.13
27 0.13
28 0.12
29 0.13
30 0.13
31 0.12
32 0.16
33 0.2
34 0.26
35 0.32
36 0.37
37 0.39
38 0.46
39 0.46
40 0.44
41 0.44
42 0.39
43 0.37
44 0.42
45 0.48
46 0.47
47 0.51
48 0.53
49 0.51
50 0.56
51 0.59
52 0.58
53 0.55
54 0.57
55 0.61
56 0.66
57 0.71
58 0.7
59 0.73
60 0.75
61 0.8