Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JAS5

Protein Details
Accession A0A1G4JAS5   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHSKKFKRHHSDRYKRVAENBasic
NLS Segment(s)
PositionSequence
8-37PKIVKKHSKKFKRHHSDRYKRVAENWRKQK
Subcellular Location(s) mito 14.5, mito_nucl 12.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHSKKFKRHHSDRYKRVAENWRKQKGIDSVVRRRFRGNIDEPNIGYGSNKKTRFMSPSGHKTFLVSNLKDLELLTMHTKTYAAEIAHNVSSKNRVVLLAKAKALGVKVTNPKGRLGLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.93
9 0.93
10 0.93
11 0.92
12 0.92
13 0.87
14 0.77
15 0.75
16 0.75
17 0.74
18 0.74
19 0.75
20 0.72
21 0.66
22 0.64
23 0.63
24 0.58
25 0.55
26 0.52
27 0.5
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.51
34 0.47
35 0.47
36 0.43
37 0.43
38 0.43
39 0.45
40 0.42
41 0.4
42 0.36
43 0.28
44 0.22
45 0.16
46 0.17
47 0.22
48 0.23
49 0.23
50 0.25
51 0.27
52 0.31
53 0.3
54 0.32
55 0.32
56 0.42
57 0.44
58 0.44
59 0.42
60 0.39
61 0.37
62 0.37
63 0.37
64 0.27
65 0.25
66 0.25
67 0.25
68 0.24
69 0.23
70 0.16
71 0.09
72 0.1
73 0.11
74 0.1
75 0.1
76 0.1
77 0.1
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.17
88 0.15
89 0.19
90 0.18
91 0.18
92 0.16
93 0.16
94 0.17
95 0.23
96 0.3
97 0.3
98 0.3
99 0.29
100 0.29
101 0.28
102 0.27
103 0.24
104 0.19
105 0.22
106 0.3
107 0.37
108 0.43
109 0.43
110 0.44
111 0.44