Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4JBP1

Protein Details
Accession A0A1G4JBP1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-73LEDLDKKDKKDKKRPPVHGYLGKBasic
183-202ILCKRCKARFSGPRRFTNMRHydrophilic
NLS Segment(s)
PositionSequence
57-65KDKKDKKRP
Subcellular Location(s) cyto_nucl 13.333, nucl 13, cyto 12.5, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013895  Rsc14  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08586  Rsc14  
Amino Acid Sequences MSEYSLGYYDTIAGLSGFECSHKVRLSLKQLEELTSRDVKARKGRENVETLEDLDKKDKKDKKRPPVHGYLGKIDAAAAANVTNEMILDTTHVLLGGHVPIAQLEALSSSDFALYFKKNLECEVAMASYDHFVNQGPSRQAQLGTPTPSSSATPSAPQVAKDDTQVQETNVKPKETDGVKKVILCKRCKARFSGPRRFTNMRQHMCMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.06
5 0.07
6 0.09
7 0.11
8 0.16
9 0.17
10 0.2
11 0.24
12 0.33
13 0.41
14 0.48
15 0.47
16 0.5
17 0.49
18 0.49
19 0.46
20 0.4
21 0.35
22 0.3
23 0.29
24 0.27
25 0.28
26 0.32
27 0.39
28 0.45
29 0.49
30 0.53
31 0.57
32 0.58
33 0.6
34 0.56
35 0.51
36 0.44
37 0.37
38 0.35
39 0.31
40 0.27
41 0.28
42 0.29
43 0.28
44 0.36
45 0.42
46 0.47
47 0.57
48 0.67
49 0.71
50 0.78
51 0.85
52 0.84
53 0.86
54 0.84
55 0.8
56 0.73
57 0.65
58 0.56
59 0.46
60 0.38
61 0.28
62 0.2
63 0.13
64 0.1
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.04
81 0.04
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.07
101 0.07
102 0.08
103 0.1
104 0.12
105 0.13
106 0.13
107 0.16
108 0.13
109 0.14
110 0.14
111 0.12
112 0.1
113 0.1
114 0.09
115 0.07
116 0.07
117 0.06
118 0.05
119 0.05
120 0.08
121 0.1
122 0.14
123 0.15
124 0.16
125 0.18
126 0.18
127 0.19
128 0.17
129 0.21
130 0.21
131 0.22
132 0.22
133 0.21
134 0.21
135 0.21
136 0.21
137 0.18
138 0.16
139 0.14
140 0.15
141 0.16
142 0.21
143 0.21
144 0.21
145 0.22
146 0.22
147 0.22
148 0.23
149 0.26
150 0.22
151 0.25
152 0.25
153 0.24
154 0.27
155 0.28
156 0.34
157 0.33
158 0.33
159 0.29
160 0.29
161 0.35
162 0.34
163 0.41
164 0.36
165 0.38
166 0.39
167 0.42
168 0.5
169 0.49
170 0.51
171 0.49
172 0.54
173 0.59
174 0.65
175 0.65
176 0.65
177 0.69
178 0.71
179 0.76
180 0.78
181 0.76
182 0.76
183 0.81
184 0.8
185 0.77
186 0.78
187 0.78
188 0.74
189 0.72