Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4J323

Protein Details
Accession A0A1G4J323    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
181-200LSRTERKMLIKKNELQHKRNHydrophilic
NLS Segment(s)
PositionSequence
102-131REKPLPKPKPPTKWELFAAKKGIKSKEKSG
Subcellular Location(s) nucl 24, mito_nucl 13.333, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSSAAEKAKYLPVVVEKPIPVTFDLGNLAVFDSNTLDANELDSSNAQREQNIQSIVRDNVQLMINQILSLPLRTTTDSNGSSGQGSSMTLVQLPEPTSELPREKPLPKPKPPTKWELFAAKKGIKSKEKSGKMVFDEATGKWVPKWGFKGANKKLDDQWLVEVDESKNKKEGDELIDPRTLSRTERKMLIKKNELQHKRNLKENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.27
4 0.3
5 0.3
6 0.29
7 0.23
8 0.22
9 0.19
10 0.16
11 0.18
12 0.15
13 0.13
14 0.12
15 0.12
16 0.09
17 0.09
18 0.08
19 0.07
20 0.08
21 0.08
22 0.09
23 0.09
24 0.08
25 0.1
26 0.11
27 0.1
28 0.1
29 0.1
30 0.11
31 0.13
32 0.16
33 0.15
34 0.15
35 0.18
36 0.21
37 0.25
38 0.26
39 0.25
40 0.23
41 0.27
42 0.27
43 0.25
44 0.21
45 0.17
46 0.17
47 0.17
48 0.15
49 0.12
50 0.13
51 0.11
52 0.11
53 0.1
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.1
61 0.11
62 0.11
63 0.16
64 0.16
65 0.17
66 0.17
67 0.17
68 0.16
69 0.15
70 0.13
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.12
86 0.13
87 0.13
88 0.17
89 0.21
90 0.22
91 0.3
92 0.39
93 0.46
94 0.52
95 0.61
96 0.65
97 0.71
98 0.72
99 0.72
100 0.65
101 0.6
102 0.55
103 0.54
104 0.49
105 0.43
106 0.45
107 0.39
108 0.39
109 0.4
110 0.43
111 0.41
112 0.42
113 0.48
114 0.52
115 0.55
116 0.57
117 0.55
118 0.54
119 0.5
120 0.5
121 0.4
122 0.32
123 0.3
124 0.24
125 0.24
126 0.19
127 0.17
128 0.13
129 0.18
130 0.17
131 0.2
132 0.24
133 0.26
134 0.34
135 0.4
136 0.51
137 0.54
138 0.62
139 0.59
140 0.58
141 0.56
142 0.55
143 0.5
144 0.41
145 0.37
146 0.3
147 0.29
148 0.26
149 0.25
150 0.19
151 0.25
152 0.26
153 0.24
154 0.27
155 0.26
156 0.26
157 0.27
158 0.31
159 0.29
160 0.37
161 0.39
162 0.37
163 0.4
164 0.39
165 0.36
166 0.34
167 0.29
168 0.24
169 0.29
170 0.32
171 0.34
172 0.42
173 0.5
174 0.56
175 0.64
176 0.7
177 0.7
178 0.71
179 0.77
180 0.8
181 0.8
182 0.76
183 0.77
184 0.77
185 0.73