Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JZN8

Protein Details
Accession A0A1G4JZN8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-140YRFEFKVPKRAKCWRRHRKNSNNIFRGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
Pfam View protein in Pfam  
PF00339  Arrestin_N  
CDD cd22952  ART10-like  
Amino Acid Sequences MPARISLDVDPPGNGQYFTSKEVLKGRVIVNLEKSTTIKKISVKFFGASEVTVRSDDHNMDGTRRNIQSPPSIGRSFHEIVSQELQVFPPSNVVQAMNGSERAFKVEEGEHDYRFEFKVPKRAKCWRRHRKNSNNIFRGAISNGIPPSFNDRLRKNQISDVGTYLYSLGRVEYRLEAALYYGRSLMWPKPFKSADVAEKRIELIPGDSASRLVGESLTPAVTPATILDSKYVFTLEDGTEAWTEVHADRLKSVYRLDLLFQQGCGKFDKIYVAFSNLETRDTLQLRLVRLQLNLLEFVTYLAGEIGNRNLSSLCLLNIATDLSIDPKTLRQRPDDDVLEAPLNLLGVEALQQFRFNEQDYKHKGNRLFSFTSCNIRREYRFQLFLDFKDENQNVFQTETQTNIVNIFCESITVQENPPPYCIDKSTDTLPVYVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.19
4 0.21
5 0.23
6 0.26
7 0.24
8 0.27
9 0.34
10 0.37
11 0.33
12 0.36
13 0.33
14 0.35
15 0.38
16 0.37
17 0.37
18 0.37
19 0.36
20 0.33
21 0.34
22 0.33
23 0.33
24 0.32
25 0.3
26 0.34
27 0.41
28 0.45
29 0.5
30 0.48
31 0.46
32 0.43
33 0.42
34 0.37
35 0.29
36 0.24
37 0.2
38 0.19
39 0.18
40 0.18
41 0.17
42 0.19
43 0.2
44 0.2
45 0.24
46 0.23
47 0.26
48 0.32
49 0.31
50 0.35
51 0.36
52 0.36
53 0.33
54 0.36
55 0.39
56 0.38
57 0.41
58 0.41
59 0.41
60 0.39
61 0.38
62 0.42
63 0.37
64 0.32
65 0.3
66 0.24
67 0.26
68 0.28
69 0.27
70 0.2
71 0.19
72 0.18
73 0.17
74 0.17
75 0.14
76 0.15
77 0.14
78 0.15
79 0.15
80 0.15
81 0.14
82 0.13
83 0.16
84 0.13
85 0.14
86 0.13
87 0.14
88 0.14
89 0.17
90 0.16
91 0.14
92 0.15
93 0.16
94 0.18
95 0.25
96 0.27
97 0.25
98 0.25
99 0.26
100 0.25
101 0.23
102 0.24
103 0.23
104 0.23
105 0.33
106 0.39
107 0.45
108 0.51
109 0.61
110 0.68
111 0.71
112 0.79
113 0.8
114 0.85
115 0.89
116 0.93
117 0.93
118 0.95
119 0.95
120 0.95
121 0.88
122 0.78
123 0.69
124 0.58
125 0.49
126 0.39
127 0.3
128 0.2
129 0.18
130 0.16
131 0.15
132 0.14
133 0.13
134 0.2
135 0.22
136 0.25
137 0.28
138 0.31
139 0.4
140 0.48
141 0.52
142 0.47
143 0.47
144 0.49
145 0.45
146 0.43
147 0.36
148 0.28
149 0.24
150 0.21
151 0.18
152 0.11
153 0.09
154 0.08
155 0.07
156 0.06
157 0.07
158 0.08
159 0.08
160 0.09
161 0.09
162 0.09
163 0.08
164 0.08
165 0.1
166 0.08
167 0.08
168 0.07
169 0.07
170 0.08
171 0.1
172 0.13
173 0.2
174 0.24
175 0.25
176 0.32
177 0.33
178 0.33
179 0.35
180 0.35
181 0.36
182 0.38
183 0.4
184 0.33
185 0.33
186 0.33
187 0.3
188 0.26
189 0.17
190 0.11
191 0.08
192 0.08
193 0.09
194 0.08
195 0.07
196 0.07
197 0.07
198 0.06
199 0.05
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.04
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.06
212 0.07
213 0.07
214 0.08
215 0.09
216 0.09
217 0.09
218 0.09
219 0.06
220 0.06
221 0.08
222 0.07
223 0.08
224 0.08
225 0.09
226 0.09
227 0.09
228 0.09
229 0.06
230 0.07
231 0.06
232 0.11
233 0.12
234 0.12
235 0.12
236 0.14
237 0.15
238 0.15
239 0.16
240 0.12
241 0.13
242 0.13
243 0.14
244 0.16
245 0.19
246 0.18
247 0.17
248 0.21
249 0.2
250 0.21
251 0.22
252 0.18
253 0.15
254 0.16
255 0.2
256 0.15
257 0.18
258 0.17
259 0.18
260 0.18
261 0.18
262 0.23
263 0.19
264 0.19
265 0.16
266 0.17
267 0.19
268 0.2
269 0.2
270 0.19
271 0.21
272 0.22
273 0.25
274 0.26
275 0.22
276 0.22
277 0.22
278 0.2
279 0.18
280 0.17
281 0.14
282 0.12
283 0.09
284 0.1
285 0.08
286 0.06
287 0.05
288 0.04
289 0.05
290 0.05
291 0.05
292 0.07
293 0.08
294 0.08
295 0.09
296 0.09
297 0.09
298 0.11
299 0.1
300 0.09
301 0.09
302 0.09
303 0.09
304 0.09
305 0.09
306 0.07
307 0.07
308 0.06
309 0.07
310 0.08
311 0.08
312 0.09
313 0.14
314 0.22
315 0.28
316 0.32
317 0.35
318 0.4
319 0.44
320 0.51
321 0.48
322 0.42
323 0.37
324 0.36
325 0.31
326 0.26
327 0.21
328 0.14
329 0.12
330 0.09
331 0.07
332 0.04
333 0.03
334 0.06
335 0.07
336 0.08
337 0.08
338 0.1
339 0.11
340 0.13
341 0.15
342 0.16
343 0.21
344 0.22
345 0.32
346 0.39
347 0.47
348 0.5
349 0.54
350 0.56
351 0.58
352 0.63
353 0.6
354 0.56
355 0.49
356 0.52
357 0.49
358 0.54
359 0.5
360 0.46
361 0.43
362 0.46
363 0.49
364 0.48
365 0.54
366 0.52
367 0.53
368 0.51
369 0.56
370 0.53
371 0.49
372 0.49
373 0.4
374 0.34
375 0.38
376 0.38
377 0.31
378 0.3
379 0.31
380 0.25
381 0.26
382 0.27
383 0.22
384 0.22
385 0.23
386 0.22
387 0.22
388 0.22
389 0.21
390 0.2
391 0.16
392 0.15
393 0.14
394 0.12
395 0.11
396 0.11
397 0.12
398 0.15
399 0.16
400 0.18
401 0.2
402 0.25
403 0.25
404 0.27
405 0.27
406 0.28
407 0.29
408 0.3
409 0.32
410 0.32
411 0.34
412 0.36
413 0.4
414 0.37